Detailed information of effector


Summary

Effector ID EFF18627 experimental
Effector type Tde
Cognate immunity protein IMU17307 experimental
Related T6SS (Type) T6SS17501 experimental (Type i3)
Strain Neisseria cinerea isolate CCUG346T (346T)
Replicon chromosome
Sequence Protein sequence (480 a.a.); Nucleotide sequence (1440 bp)
Description Nte5 is predicted to be an HNH/endo VII nuclease with conserved AHH (pfam14412). All Ntes are toxic, with their expression leading to decreased viability and reduced optical density (OD) of E. coli cultures compared to empty vector controls; toxicity was counteracted by co-expression of the corresponding Nti.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Nte5
Coordinates (Strand) 15317..16756 (-)
NCBI ID -
GenBank 346T_plasmid
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AHH PF14412.8 5.8e-17 344..456
RHS PF03527.16 5.6e-12 233..265

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-479 MGRLKSQRTVRSGTQTPRGKQNPPAGGAVNRRYAYDKAGNLIQSADQRSGVLHYVYDKIGRIQEARNSQTGRSETFAFDPAHNILSDKTAEGKDKGSNISSGNRLESYNGIEYTYDALGNLIYRQLPNGENQYYQYDLENQLVRAEIKKPAGNTEIWEYAYDPFGRRLSKERQDKLAWTSTDPKRTHFVWDGSRLLQEYTYKGSYTYLYTDQDSYEPLAQIFDNAKDSKQYLAYFHNDQIGIPREMTDIHGNLLWYGEYTAWGRLKKDGRVYQHAHQPFRLQNQYYDEETGLHYNLMRYYEPEAGRFVNQDPIGLWGGDNLYAFAPNTQEWIDPLGESGYRLRKSMESQGMFRPASSWQTHHLIPQAVWKENKAFFNSIGMKGKGLGRDSWTNGLYMPSTEADARGALREFFHQGSHNNYSDSVSRELQKIRGEFQQGKITAAQARKRVQNLQKRLKKRLSKSLSVGGCGSTNSPKRLD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9359 - -



  Protein sequence: 480 a.a.    .

>EFF18627 346T_plasmid:c16756-15317 [synthetic DNA construct]
MGRLKSQRTVRSGTQTPRGKQNPPAGGAVNRRYAYDKAGNLIQSADQRSGVLHYVYDKIGRIQEARNSQTGRSETFAFDP
AHNILSDKTAEGKDKGSNISSGNRLESYNGIEYTYDALGNLIYRQLPNGENQYYQYDLENQLVRAEIKKPAGNTEIWEYA
YDPFGRRLSKERQDKLAWTSTDPKRTHFVWDGSRLLQEYTYKGSYTYLYTDQDSYEPLAQIFDNAKDSKQYLAYFHNDQI
GIPREMTDIHGNLLWYGEYTAWGRLKKDGRVYQHAHQPFRLQNQYYDEETGLHYNLMRYYEPEAGRFVNQDPIGLWGGDN
LYAFAPNTQEWIDPLGESGYRLRKSMESQGMFRPASSWQTHHLIPQAVWKENKAFFNSIGMKGKGLGRDSWTNGLYMPST
EADARGALREFFHQGSHNNYSDSVSRELQKIRGEFQQGKITAAQARKRVQNLQKRLKKRLSKSLSVGGCGSTNSPKRLD*

  Nucleotide sequence: 1440 bp    .

>EFF18627 346T_plasmid:c16756-15317 [synthetic DNA construct]
ATGGGTCGTCTGAAAAGCCAGCGTACCGTCCGCAGCGGCACACAAACACCCCGCGGCAAACAAAACCCGCCGGCCGGCGG
CGCCGTCAACCGCCGCTACGCCTACGACAAAGCCGGCAACCTGATTCAAAGTGCCGACCAAAGAAGCGGCGTCCTTCATT
ACGTTTACGACAAAATCGGACGGATTCAGGAAGCCCGCAACAGCCAAACCGGCCGCAGCGAAACCTTCGCCTTCGACCCC
GCCCACAACATCCTTTCCGACAAAACAGCCGAAGGGAAGGACAAAGGCAGTAACATTAGCAGCGGCAACCGCCTAGAATC
ATACAACGGCATCGAATACACCTACGACGCACTGGGCAACCTGATCTACCGCCAGCTGCCCAACGGTGAAAACCAATATT
ACCAATACGATTTAGAAAACCAACTCGTCCGCGCCGAAATCAAAAAGCCCGCCGGTAATACCGAGATTTGGGAATATGCC
TATGACCCGTTCGGAAGACGCCTTTCCAAAGAACGCCAAGACAAACTCGCCTGGACGAGCACCGACCCCAAACGCACCCA
CTTCGTCTGGGACGGCAGCCGCCTATTGCAGGAGTACACCTACAAAGGCAGCTACACCTATCTCTACACCGACCAAGACA
GCTACGAACCGCTGGCGCAAATCTTTGATAACGCCAAAGACAGCAAACAATACCTCGCCTATTTCCACAACGACCAAATC
GGCATACCGAGGGAGATGACCGACATCCACGGCAATCTCTTATGGTACGGCGAATACACCGCCTGGGGTCGTCTGAAAAA
GGACGGGCGGGTCTATCAGCACGCGCATCAGCCGTTTAGATTGCAGAACCAGTATTATGATGAAGAGACCGGGCTGCATT
ACAACCTGATGCGCTATTACGAGCCTGAGGCCGGGCGGTTTGTAAATCAGGACCCGATTGGGTTGTGGGGTGGGGATAAT
TTGTATGCTTTTGCGCCTAACACTCAAGAATGGATTGACCCATTGGGGGAGAGTGGCTATCGCTTGCGTAAGAGTATGGA
ATCTCAGGGAATGTTCCGTCCAGCTTCTTCTTGGCAGACACACCATTTAATTCCACAGGCAGTTTGGAAAGAAAATAAAG
CATTTTTTAATAGTATTGGCATGAAAGGCAAAGGACTAGGCAGAGATAGTTGGACTAATGGTCTGTATATGCCTTCAACG
GAAGCGGATGCTCGGGGCGCACTTAGAGAATTTTTCCATCAAGGGTCGCATAATAACTACAGTGATAGTGTAAGTCGCGA
GTTGCAAAAAATAAGAGGCGAATTTCAACAAGGAAAGATTACAGCAGCACAAGCGCGAAAACGTGTACAGAATTTACAAA
AAAGGTTGAAAAAACGCTTAAGTAAGTCTTTATCCGTTGGAGGGTGCGGATCTACCAACTCGCCCAAACGATTAGATTAG