Detailed information of effector


Summary

Effector ID EFF18625 experimental
Effector type Tde
Cognate immunity protein IMU17305 experimental
Related T6SS (Type) T6SS17501 experimental (Type i3)
Strain Neisseria cinerea isolate CCUG346T (346T)
Replicon chromosome
Sequence Protein sequence (1368 a.a.); Nucleotide sequence (4104 bp)
Description Nte3 is a putative endonuclease of the HNH/Endo VII family with conserved LHH (pfam14411). All Ntes are toxic, with their expression leading to decreased viability and reduced optical density (OD) of E. coli cultures compared to empty vector controls; toxicity was counteracted by co-expression of the corresponding Nti.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Nte3
Coordinates (Strand) 21905..26008 (-)
NCBI ID -
GenBank 346T_plasmid
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 2.5e-21 126..200
LHH PF14411.8 1.1e-11 1291..1356
RHS PF03527.16 1.9e-11 1140..1172
RHS_repeat PF05593.16 3.1e-08 526..555
RHS_repeat PF05593.16 1.3e-06 625..661
RHS_repeat PF05593.16 6.2e-06 478..512

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1367 MASFGNTFGVLIPKPAAPAMVSQGSANPPEPLTNAAGPVDVIEMVADVASTALSIVASDSAAADTVDAISELVSLASMIPGQPGPKPPSRKMVSGFSGGMGMGFDGGVVTSGHGHCIPCKVAAAIGNPVNAVLGIKVLFDDTETDFAFDSPLPLVWQRSYYSDQIGNGWLGQGWSLPFSMRLVRTADGFLYIDEQGREIPLPDISDKADEPYSAADDDEDDLYEEEAAPRPASAEEDPYGLDDAYFDPYEQIFFSQISDDLYQIASPDGGARLLFAEVDSGCGIYQLVAQLDRNGRHIRLCYDDNGLPHSIYDGSGRHFQPVFSSIRLHDNDPDFDPAGERDVFVSKDERFYVNRLTSVTFNGKELVRYDYDGYGDLTAVYGRDSKKLRGFAYRNHIMVEHNQPDGLVSRYEYDRYDTDGKVLKSSNNLGEEWTFDYRKDHTVVTDALGRTEVYGFDENHELVYRIDADGQRSDSERDSYGRITVERDPLGRETRYLYDTEGNVIAITAPDGGSTQIDYHETLNLPVAVNDPAGRITAYTYDGRGNLVSITDPAGYTTRYGYNARWLPETITDALGKTRRLHYDTLDQLVCFTDCTGETTRFAYTEYGDLETVTDALGHTTRHHYDAAGNPVRTDYPDGSHETFEYDRLNRLTAHIDGLGAQTAYELAVDGLPLKRTNALGHTFAYAYDKARRLTVLTNENGETYRLDYGPTDNLIQETGWDGKITAYGYDAAGQLVQQTEYGQSNNEGRLKDRPETWHIHRFKRNILGQLIEKQSRKVSGRNGQSKDEGISRTRFDYDPITGNLTKARNRHSSVELAYDELDHLIGETTVHNGQSATVGYQYDPLGNRIRTILPDGRHIDYLYYGSGHLHQISLDGEVITDIERDKLHREIQRTQGSISSLYDYDPMGRLKSQRTVRSGTQTPRGKQNPPAGGAVNRRYAYDKAGNLIQSADQRSGVLHYVYDKIGRIQEARNSQTGRSETFAFDPAHNILSDKTAEGKDKGSNISSGNRLESYNGIEYTYDALGNLIYRQLPNGENQYYQYDLENQLVRAEIKKPAGNTEIWEYAYDPFGRRLSKERQDKLAWTSTDPKRTHFVWDGSRLLQEYTYKGSYTYLYTDQDSYEPLAQIFDNAKDSKQYLAYFHNDQIGIPREMTDIHGNLLWYGEYTAWGRLKKDGRVYQHAHQPFRLQNQYYDEETGLHYNLMRYYEPEAGRFVNQDPIGLLGGENLYWFAPNVFNWLDLFGLNRTPISFTSSTGLTLSVTGYTGLQHLSDSQVKSLAYLNGPENKRPFGKSPVDKKGNTIILHHYKQQSQGPIIAMPERCHRENSKALHPLGNKGGIDNRDEFNQWKREFWYDQALKELSRRGIK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7491 - -



  Protein sequence: 1368 a.a.    .

>EFF18625 346T_plasmid:c26008-21905 [synthetic DNA construct]
MASFGNTFGVLIPKPAAPAMVSQGSANPPEPLTNAAGPVDVIEMVADVASTALSIVASDSAAADTVDAISELVSLASMIP
GQPGPKPPSRKMVSGFSGGMGMGFDGGVVTSGHGHCIPCKVAAAIGNPVNAVLGIKVLFDDTETDFAFDSPLPLVWQRSY
YSDQIGNGWLGQGWSLPFSMRLVRTADGFLYIDEQGREIPLPDISDKADEPYSAADDDEDDLYEEEAAPRPASAEEDPYG
LDDAYFDPYEQIFFSQISDDLYQIASPDGGARLLFAEVDSGCGIYQLVAQLDRNGRHIRLCYDDNGLPHSIYDGSGRHFQ
PVFSSIRLHDNDPDFDPAGERDVFVSKDERFYVNRLTSVTFNGKELVRYDYDGYGDLTAVYGRDSKKLRGFAYRNHIMVE
HNQPDGLVSRYEYDRYDTDGKVLKSSNNLGEEWTFDYRKDHTVVTDALGRTEVYGFDENHELVYRIDADGQRSDSERDSY
GRITVERDPLGRETRYLYDTEGNVIAITAPDGGSTQIDYHETLNLPVAVNDPAGRITAYTYDGRGNLVSITDPAGYTTRY
GYNARWLPETITDALGKTRRLHYDTLDQLVCFTDCTGETTRFAYTEYGDLETVTDALGHTTRHHYDAAGNPVRTDYPDGS
HETFEYDRLNRLTAHIDGLGAQTAYELAVDGLPLKRTNALGHTFAYAYDKARRLTVLTNENGETYRLDYGPTDNLIQETG
WDGKITAYGYDAAGQLVQQTEYGQSNNEGRLKDRPETWHIHRFKRNILGQLIEKQSRKVSGRNGQSKDEGISRTRFDYDP
ITGNLTKARNRHSSVELAYDELDHLIGETTVHNGQSATVGYQYDPLGNRIRTILPDGRHIDYLYYGSGHLHQISLDGEVI
TDIERDKLHREIQRTQGSISSLYDYDPMGRLKSQRTVRSGTQTPRGKQNPPAGGAVNRRYAYDKAGNLIQSADQRSGVLH
YVYDKIGRIQEARNSQTGRSETFAFDPAHNILSDKTAEGKDKGSNISSGNRLESYNGIEYTYDALGNLIYRQLPNGENQY
YQYDLENQLVRAEIKKPAGNTEIWEYAYDPFGRRLSKERQDKLAWTSTDPKRTHFVWDGSRLLQEYTYKGSYTYLYTDQD
SYEPLAQIFDNAKDSKQYLAYFHNDQIGIPREMTDIHGNLLWYGEYTAWGRLKKDGRVYQHAHQPFRLQNQYYDEETGLH
YNLMRYYEPEAGRFVNQDPIGLLGGENLYWFAPNVFNWLDLFGLNRTPISFTSSTGLTLSVTGYTGLQHLSDSQVKSLAY
LNGPENKRPFGKSPVDKKGNTIILHHYKQQSQGPIIAMPERCHRENSKALHPLGNKGGIDNRDEFNQWKREFWYDQALKE
LSRRGIK*

  Nucleotide sequence: 4104 bp    .

>EFF18625 346T_plasmid:c26008-21905 [synthetic DNA construct]
ATGGCCTCTTTCGGTAACACTTTCGGTGTTCTCATTCCTAAACCAGCCGCCCCAGCCATGGTGTCTCAAGGCTCTGCCAA
TCCACCCGAGCCGCTGACCAATGCAGCCGGTCCGGTGGATGTGATAGAAATGGTTGCCGATGTTGCTTCCACTGCCCTTT
CCATCGTTGCGTCTGATTCTGCCGCAGCTGATACAGTTGATGCCATATCCGAACTGGTTTCCCTTGCGTCCATGATACCC
GGTCAGCCGGGTCCCAAGCCCCCTTCCCGTAAAATGGTCAGCGGTTTCAGCGGTGGTATGGGTATGGGTTTTGATGGTGG
GGTGGTTACCTCGGGTCATGGTCACTGTATTCCTTGTAAGGTGGCCGCAGCTATCGGTAATCCTGTAAACGCAGTGCTCG
GTATCAAAGTCCTATTTGACGATACCGAGACCGACTTTGCCTTCGATTCCCCGCTTCCCCTTGTTTGGCAGCGCAGCTAC
TATTCCGACCAAATAGGCAACGGCTGGCTGGGGCAAGGTTGGTCGCTGCCGTTCTCCATGCGTCTTGTCCGGACTGCCGA
CGGTTTCCTCTATATTGATGAGCAGGGCAGGGAAATTCCGTTGCCGGATATCAGCGACAAAGCGGACGAGCCTTATTCCG
CAGCCGACGACGATGAAGACGATCTATATGAAGAAGAGGCTGCGCCAAGACCTGCTTCCGCCGAAGAAGATCCCTACGGT
TTGGATGACGCCTATTTTGATCCTTACGAACAAATCTTCTTTTCACAGATTTCAGACGACCTCTATCAAATCGCCTCCCC
CGACGGCGGCGCACGGCTGTTGTTTGCCGAAGTCGATTCCGGCTGCGGCATTTACCAACTGGTCGCCCAACTCGACCGCA
ACGGCCGCCATATCCGCCTCTGCTACGACGACAACGGGCTGCCGCACAGCATTTACGACGGCAGCGGCCGACATTTCCAA
CCCGTATTCTCCTCCATCCGTCTGCACGACAACGATCCCGACTTCGACCCGGCCGGAGAACGGGACGTCTTCGTTTCCAA
AGACGAACGTTTCTACGTCAACCGCCTCACCTCCGTCACCTTCAACGGCAAGGAACTGGTGCGCTACGACTACGACGGCT
ACGGCGATTTGACCGCCGTTTACGGACGCGACAGCAAAAAACTGCGCGGTTTTGCCTACCGCAACCACATCATGGTCGAA
CACAACCAGCCCGACGGACTGGTATCCCGCTACGAATACGACCGTTACGACACCGACGGCAAAGTGCTCAAAAGCAGCAA
CAACCTCGGCGAAGAATGGACGTTCGACTACCGCAAAGACCATACCGTCGTTACCGACGCATTGGGACGGACGGAAGTGT
ACGGTTTCGACGAAAACCACGAACTCGTCTACCGCATCGACGCCGACGGACAACGCAGCGACAGCGAACGCGACAGCTAC
GGCCGCATTACCGTAGAACGCGACCCCCTCGGACGCGAAACCCGCTATCTCTACGATACCGAAGGCAACGTCATCGCCAT
CACCGCCCCCGACGGCGGCAGCACCCAAATCGACTACCACGAAACCCTCAACCTGCCGGTTGCCGTCAACGATCCCGCCG
GCAGGATTACCGCCTACACCTACGACGGACGCGGCAACCTCGTCAGCATCACCGATCCCGCCGGTTACACCACCCGCTAC
GGCTACAACGCCCGATGGCTGCCCGAAACTATTACCGACGCCTTAGGCAAAACCCGACGCCTACACTACGACACCCTCGA
CCAACTCGTCTGCTTTACCGACTGTACCGGCGAAACCACCCGCTTCGCTTATACCGAATACGGCGATCTCGAAACCGTTA
CCGATGCGCTGGGCCATACCACCCGCCACCACTACGACGCAGCGGGCAACCCCGTCCGTACCGACTATCCCGACGGCAGT
CACGAAACCTTCGAATACGACCGCCTCAACCGTCTGACCGCCCACATCGACGGACTCGGTGCCCAAACCGCCTACGAACT
CGCAGTGGACGGACTGCCGCTCAAACGCACCAACGCACTGGGCCATACCTTCGCCTACGCCTACGACAAAGCCCGCCGTC
TGACCGTCCTCACCAACGAAAACGGCGAAACCTACCGTCTCGATTACGGCCCGACCGACAACCTGATCCAAGAAACCGGC
TGGGACGGCAAAATCACCGCCTACGGCTACGATGCCGCCGGACAACTGGTTCAACAGACCGAATACGGCCAAAGCAATAA
TGAAGGTCGTCTGAAAGACCGTCCCGAGACTTGGCACATCCACCGGTTCAAACGCAACATCCTCGGCCAACTGATCGAAA
AACAAAGCCGCAAAGTCTCCGGCCGCAACGGACAAAGCAAAGACGAAGGCATCAGCCGCACCCGTTTCGACTACGACCCC
ATTACCGGCAACCTGACCAAAGCCCGCAACCGACACAGCAGCGTCGAACTCGCCTACGACGAACTCGACCACCTCATCGG
CGAAACCACCGTCCACAACGGCCAAAGCGCCACCGTAGGCTATCAATACGACCCGCTGGGCAACCGCATCCGCACCATCC
TGCCCGACGGCCGCCATATCGATTACCTGTACTACGGCAGCGGACACCTGCACCAAATCAGCCTAGACGGCGAAGTCATC
ACCGACATCGAACGCGACAAACTGCACCGCGAAATCCAAAGGACGCAGGGCAGCATCAGCAGCCTGTACGACTACGACCC
CATGGGTCGTCTGAAAAGCCAGCGTACCGTCCGCAGCGGCACACAAACACCCCGCGGCAAACAAAACCCGCCGGCCGGCG
GCGCCGTCAACCGCCGCTACGCCTACGACAAAGCCGGCAACCTGATTCAAAGTGCCGACCAAAGAAGCGGCGTCCTTCAT
TACGTTTACGACAAAATCGGACGGATTCAGGAAGCCCGCAACAGCCAAACCGGCCGCAGCGAAACCTTCGCCTTCGACCC
CGCCCACAACATCCTTTCCGACAAAACAGCCGAAGGGAAGGACAAAGGCAGTAACATTAGCAGCGGCAACCGCCTAGAAT
CATACAACGGCATCGAATACACCTACGACGCACTGGGCAACCTGATCTACCGCCAGCTGCCCAACGGTGAAAACCAATAT
TACCAATACGATTTAGAAAACCAACTCGTCCGCGCCGAAATCAAAAAGCCCGCCGGTAATACCGAGATTTGGGAATATGC
CTATGACCCGTTCGGAAGACGCCTTTCCAAAGAACGCCAAGACAAACTCGCCTGGACGAGCACCGACCCCAAACGCACCC
ACTTCGTCTGGGACGGCAGCCGCCTATTGCAGGAGTACACCTACAAAGGCAGCTACACCTATCTCTACACCGACCAAGAC
AGCTACGAACCGCTGGCGCAAATCTTTGATAACGCCAAAGACAGCAAACAATACCTCGCCTATTTCCACAACGACCAAAT
CGGCATACCGAGGGAGATGACCGACATCCACGGCAATCTCTTATGGTACGGCGAATACACCGCCTGGGGTCGTCTGAAAA
AGGACGGGCGGGTCTATCAGCACGCGCATCAGCCGTTTAGATTGCAGAACCAGTATTATGATGAAGAGACCGGGCTGCAT
TACAACCTGATGCGCTATTACGAGCCTGAGGCCGGGCGGTTTGTGAATCAGGATCCGATTGGGTTGTTGGGCGGGGAAAA
TCTTTATTGGTTTGCACCTAACGTTTTTAATTGGCTAGATTTATTTGGCCTGAATAGAACACCTATATCCTTTACAAGCT
CTACAGGACTAACTTTGTCTGTTACAGGCTATACAGGGCTGCAACATTTATCAGACTCTCAAGTAAAAAGTCTTGCCTAT
TTAAATGGTCCTGAAAACAAAAGACCCTTCGGCAAGTCTCCTGTTGACAAAAAAGGAAATACAATTATTCTTCACCACTA
TAAACAACAAAGCCAAGGTCCTATTATTGCCATGCCTGAACGCTGTCATCGCGAAAATTCCAAGGCTTTGCATCCATTAG
GAAATAAAGGCGGCATTGACAATAGAGATGAATTTAATCAATGGAAGCGCGAGTTCTGGTACGACCAAGCTTTAAAAGAA
TTATCAAGAAGAGGTATTAAATGA