Detailed information of effector


Summary

Effector ID EFF18624 experimental
Effector type Tde
Cognate immunity protein IMU17304 experimental
Related T6SS (Type) T6SS17501 experimental (Type i3)
Strain Neisseria cinerea isolate CCUG346T (346T)
Replicon chromosome
Sequence Protein sequence (1370 a.a.); Nucleotide sequence (4110 bp)
Description Nte2 contains an N-terminal PAAR domain and has a predicted RNase domain (pfam15606) in its C-terminal region. All Ntes are toxic, with their expression leading to decreased viability and reduced optical density (OD) of E. coli cultures compared to empty vector controls; toxicity was counteracted by co-expression of the corresponding Nti.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Nte2
Coordinates (Strand) 53253..57362 (+)
NCBI ID -
GenBank 346T_plasmid
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ntox34 PF15606.8 9.3e-26 1291..1360
DUF4150 PF13665.8 1.6e-19 15..122
DUF6531 PF20148.1 1.4e-18 142..213
RHS PF03527.16 1.4e-13 1152..1187
RHS_repeat PF05593.16 7.5e-07 459..494
RHS_repeat PF05593.16 1.9e-06 505..533
RHS_repeat PF05593.16 6.8e-06 584..620
RHS_repeat PF05593.16 4.4e-05 626..662
RHS_repeat PF05593.16 6e-05 544..569

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1369 MAFNKIARKSSDFRVVFTVPDFCWPPPPAPPVAPPIPFPLFADLGGAQTVANDVRLNRKPAFVFKASKTNRTTGDEPAIPGRKGVLSRTATKPAWPMMHSSSVKIRKRHIIRAGDMFHMNNKFKKKLPPKPCISCKAAAAVGRPVNPIHGLKFLEGETDFAFEGILPLVWSRSYYSDQDGTGWLGEGWSVPGCQRIIRDAAGLAYIDDQGRLFPLPEVDEDDEEPVLFESEQIWFSKNPDGHYVIASLDGSIALRFAPLAVAEDGSDEDSTLFPLVAVEDANGNHQRFVYHPLTGLPQYVIDGNGRVFSLNFGNVADEQSPKMRLLSVSLLEGLPAFGETVRVGSPLIRYEYNNSGDLVRVIGRDGNVKRSFGYRNNLMVSHTDAAGLVSEYEYDHYTPTGKVLCNRTSLGEEWRFTYHDGYTEVTDVLGRTEQYHYDYNNELTKRVFADGSAVLMERDGLGRLLGHTDAMGRVTRYQYSNEGQVEAIVRPDGTILHFDYDDCYRLIRKSDAEGRYDGYTYDEAGNLLTHTDPLKHTTRFEYADNGLLQSVTDPNGNSTAYHYNENRRPDLITDCSGYETRLAYTPEGQLARITDALGRHTEYHYDADQNLTLALYPDGSKETFGYDAAGRLKTHTDGEGHTTSYEYGQDGLPTRRTNALGHTFGYHYDKARRLIGLTNENGARYRFAYDVLDRLIAESGFDHKLTGYRYNAGNELVEQREFGDDASLAAKLMAQPGGQPVPKKDAAPLSDDLDSQTPLRITEFKRDILGRLIHTLARDGGDRVQEAAYQYDPDGNLVRAANRHSITCFDYNGNGQIIARHQWKVPTKEENARNGLPETDWRDAQYDMLYLPVTETIRYHYDFNGNRTATVLPDGRQINCLYYGSGHLHQISLEDEVITDIERDKLHREIFRTQGKLASRYELDPLGRLKRQIAALNGLTEGGKGKTKVAAGYSQTAVKRSYGYDRTGNLAHSTDQRTGTTHFEFDRLGRITKAGSERFAFDPAHNILSDHNSPTVQDNRLKEYNGSSYYYDGFGNLIHRELADGEVQNYFYDLHDQLVKAEIFKKDGSKETWAYTYDALGRRIGKGRLKNEEVSDGLEEETGFVWDGSHLLQEVHPDGRYTYLYTDQDSYEPLAQVRNWTTEDGESRQQTHYFHCDQIGIPREMTDKDGNLVWFGDYYGWGKLRSETNVTGTAHQPFRLQNQYCDRETGLHYNFFRYYEPNIGRFVNQDPIKLKGGNNLYQFAFNTQIWIDPKGLVAFAIPVIAPELVALGKATLLLLGLGAAHEGSKAIGTMMAANGNQVDTGVANQVYEKINEYSRTTGKKPDKCDVLQELIDCGQISAKQAKSTQKAWGCRHSRHSKDKCNNRKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9112 - -



  Protein sequence: 1370 a.a.    .

>EFF18624 346T_plasmid:53253-57362 [synthetic DNA construct]
MAFNKIARKSSDFRVVFTVPDFCWPPPPAPPVAPPIPFPLFADLGGAQTVANDVRLNRKPAFVFKASKTNRTTGDEPAIP
GRKGVLSRTATKPAWPMMHSSSVKIRKRHIIRAGDMFHMNNKFKKKLPPKPCISCKAAAAVGRPVNPIHGLKFLEGETDF
AFEGILPLVWSRSYYSDQDGTGWLGEGWSVPGCQRIIRDAAGLAYIDDQGRLFPLPEVDEDDEEPVLFESEQIWFSKNPD
GHYVIASLDGSIALRFAPLAVAEDGSDEDSTLFPLVAVEDANGNHQRFVYHPLTGLPQYVIDGNGRVFSLNFGNVADEQS
PKMRLLSVSLLEGLPAFGETVRVGSPLIRYEYNNSGDLVRVIGRDGNVKRSFGYRNNLMVSHTDAAGLVSEYEYDHYTPT
GKVLCNRTSLGEEWRFTYHDGYTEVTDVLGRTEQYHYDYNNELTKRVFADGSAVLMERDGLGRLLGHTDAMGRVTRYQYS
NEGQVEAIVRPDGTILHFDYDDCYRLIRKSDAEGRYDGYTYDEAGNLLTHTDPLKHTTRFEYADNGLLQSVTDPNGNSTA
YHYNENRRPDLITDCSGYETRLAYTPEGQLARITDALGRHTEYHYDADQNLTLALYPDGSKETFGYDAAGRLKTHTDGEG
HTTSYEYGQDGLPTRRTNALGHTFGYHYDKARRLIGLTNENGARYRFAYDVLDRLIAESGFDHKLTGYRYNAGNELVEQR
EFGDDASLAAKLMAQPGGQPVPKKDAAPLSDDLDSQTPLRITEFKRDILGRLIHTLARDGGDRVQEAAYQYDPDGNLVRA
ANRHSITCFDYNGNGQIIARHQWKVPTKEENARNGLPETDWRDAQYDMLYLPVTETIRYHYDFNGNRTATVLPDGRQINC
LYYGSGHLHQISLEDEVITDIERDKLHREIFRTQGKLASRYELDPLGRLKRQIAALNGLTEGGKGKTKVAAGYSQTAVKR
SYGYDRTGNLAHSTDQRTGTTHFEFDRLGRITKAGSERFAFDPAHNILSDHNSPTVQDNRLKEYNGSSYYYDGFGNLIHR
ELADGEVQNYFYDLHDQLVKAEIFKKDGSKETWAYTYDALGRRIGKGRLKNEEVSDGLEEETGFVWDGSHLLQEVHPDGR
YTYLYTDQDSYEPLAQVRNWTTEDGESRQQTHYFHCDQIGIPREMTDKDGNLVWFGDYYGWGKLRSETNVTGTAHQPFRL
QNQYCDRETGLHYNFFRYYEPNIGRFVNQDPIKLKGGNNLYQFAFNTQIWIDPKGLVAFAIPVIAPELVALGKATLLLLG
LGAAHEGSKAIGTMMAANGNQVDTGVANQVYEKINEYSRTTGKKPDKCDVLQELIDCGQISAKQAKSTQKAWGCRHSRHS
KDKCNNRKK*

  Nucleotide sequence: 4110 bp    .

>EFF18624 346T_plasmid:53253-57362 [synthetic DNA construct]
ATGGCATTCAATAAAATCGCCCGTAAAAGCAGTGACTTCAGGGTCGTCTTTACCGTCCCCGATTTCTGCTGGCCGCCCCC
TCCTGCTCCACCAGTCGCACCACCCATCCCCTTCCCACTCTTCGCCGACCTCGGCGGTGCCCAAACCGTCGCCAATGACG
TACGCCTCAACCGCAAGCCTGCCTTCGTCTTCAAAGCCAGTAAAACCAACCGCACTACCGGCGACGAACCCGCCATACCC
GGCCGCAAAGGGGTGTTGTCGCGTACCGCCACCAAACCTGCCTGGCCGATGATGCACTCTTCTTCGGTTAAAATCCGCAA
GCGCCACATCATCCGTGCCGGCGATATGTTCCACATGAACAACAAGTTCAAGAAGAAACTGCCGCCCAAACCCTGTATTT
CCTGTAAAGCCGCCGCCGCTGTCGGCCGCCCGGTCAATCCGATACACGGGCTGAAGTTTTTGGAGGGTGAAACCGACTTT
GCTTTTGAAGGCATCCTGCCGCTGGTCTGGAGCCGCAGCTATTATTCCGACCAAGACGGTACCGGCTGGCTCGGCGAGGG
CTGGAGCGTGCCGGGCTGCCAACGCATCATCCGCGATGCGGCGGGATTGGCCTATATCGACGATCAGGGCCGTTTGTTCC
CGCTGCCGGAAGTCGATGAAGACGATGAAGAGCCGGTATTGTTCGAGAGCGAACAGATCTGGTTCAGTAAAAATCCGGAC
GGCCATTATGTCATTGCGTCGCTGGACGGTTCGATAGCGCTGCGCTTTGCACCTTTGGCGGTGGCGGAAGACGGTTCGGA
CGAGGATTCCACCCTCTTCCCGCTGGTGGCGGTGGAAGACGCCAACGGCAACCATCAGCGTTTCGTCTATCATCCGCTGA
CCGGTCTGCCGCAATACGTCATCGACGGCAACGGCCGGGTGTTCTCGCTGAACTTCGGTAATGTGGCGGACGAACAGTCG
CCCAAAATGCGGCTGCTGTCGGTATCGCTGTTGGAGGGGTTGCCCGCCTTCGGCGAAACGGTCCGGGTCGGCAGTCCGCT
GATCCGCTACGAATACAATAATAGCGGCGACTTGGTCCGCGTCATCGGCCGAGACGGCAACGTCAAACGCAGCTTCGGCT
ATAGAAACAATCTGATGGTGTCGCACACGGATGCGGCGGGATTGGTATCGGAATACGAATACGACCATTACACCCCGACC
GGCAAGGTGTTGTGCAACCGGACTTCTTTGGGCGAGGAATGGCGTTTTACCTATCACGACGGTTATACCGAGGTAACCGA
CGTGTTGGGCCGTACCGAGCAATATCATTACGACTACAACAACGAGTTGACCAAACGGGTGTTTGCCGACGGCAGCGCCG
TATTGATGGAACGCGACGGTTTGGGCCGTCTGCTCGGCCATACCGATGCGATGGGGCGCGTGACCCGTTATCAGTACAGC
AACGAGGGGCAGGTGGAGGCCATCGTCCGTCCCGACGGCACCATCCTGCATTTCGACTATGACGACTGCTACCGCCTGAT
TCGTAAAAGCGATGCGGAAGGCCGTTATGACGGCTATACCTACGACGAAGCGGGCAACCTGCTGACCCATACCGACCCGC
TGAAACATACCACCCGTTTCGAATACGCCGACAACGGCCTGTTGCAGTCGGTGACCGACCCCAACGGCAACAGCACCGCC
TATCACTATAATGAAAACCGCCGGCCCGACCTCATTACCGACTGCTCCGGTTACGAAACCCGTCTGGCCTACACCCCCGA
AGGACAGCTGGCGCGTATTACCGATGCGCTGGGACGGCACACCGAATATCATTACGACGCCGACCAAAACCTTACCCTCG
CCCTCTATCCCGACGGCAGCAAAGAAACCTTCGGCTACGATGCCGCAGGCCGTCTGAAAACCCATACCGACGGCGAAGGC
CATACCACTTCCTACGAATACGGCCAGGACGGTCTGCCGACCCGGCGCACCAATGCGCTGGGCCATACCTTCGGCTACCA
CTACGACAAAGCCCGCCGCCTAATCGGCCTCACCAATGAAAACGGTGCGCGCTACCGCTTTGCCTACGACGTCCTCGACC
GCCTGATTGCCGAAAGCGGCTTCGACCATAAGCTGACCGGCTACCGCTACAACGCCGGCAACGAACTGGTCGAGCAGCGC
GAGTTCGGCGACGATGCCTCCCTCGCCGCCAAACTGATGGCGCAGCCGGGCGGACAGCCCGTCCCCAAAAAAGACGCCGC
CCCGCTTTCAGACGACCTCGACAGCCAAACCCCGCTGCGGATTACCGAGTTCAAACGCGATATATTGGGACGCTTAATCC
ATACCCTCGCCCGCGACGGCGGCGACAGAGTTCAGGAGGCCGCTTACCAATACGACCCGGACGGCAACCTCGTCCGCGCC
GCCAACCGCCACAGCATCACCTGCTTCGACTACAACGGAAACGGCCAAATCATCGCCCGGCACCAATGGAAGGTGCCGAC
TAAGGAAGAGAACGCCCGAAACGGCCTGCCCGAAACCGACTGGCGCGATGCGCAGTACGACATGCTGTACCTGCCCGTCA
CCGAAACCATCCGCTACCACTACGACTTCAACGGCAACCGTACCGCCACCGTCCTGCCCGACGGCAGACAGATCAACTGC
CTGTATTACGGCAGCGGACACCTGCACCAAATCAGCCTCGAAGACGAAGTCATCACCGACATCGAACGCGATAAGCTGCA
CCGCGAAATCTTCCGCACACAGGGTAAACTGGCCAGCCGTTACGAACTCGATCCCTTAGGCCGTCTGAAAAGGCAAATCG
CCGCACTCAATGGATTGACCGAAGGCGGCAAAGGCAAAACCAAAGTCGCAGCGGGTTATAGCCAAACCGCCGTCAAACGC
AGCTACGGCTACGACCGCACCGGCAATCTGGCCCACAGTACCGACCAACGGACGGGCACGACGCATTTCGAGTTCGACAG
ACTCGGTCGAATCACCAAAGCCGGCAGCGAACGGTTCGCCTTCGACCCTGCGCACAATATCCTGTCCGATCACAACAGCC
CTACCGTTCAAGACAACCGTCTTAAAGAATACAACGGCAGCAGCTATTACTACGACGGCTTCGGCAACCTGATCCACCGC
GAGCTGGCCGACGGCGAAGTGCAGAACTACTTCTACGATCTGCATGACCAACTGGTTAAAGCCGAAATCTTCAAAAAAGA
CGGCAGCAAAGAAACTTGGGCCTACACCTACGATGCCTTGGGCAGGAGGATAGGCAAAGGCCGTCTGAAAAACGAAGAAG
TTTCAGACGGCCTCGAAGAGGAAACCGGGTTTGTTTGGGACGGCAGCCATTTGCTGCAGGAAGTCCACCCGGACGGCAGG
TATACCTATCTCTACACCGACCAAGACTCCTACGAACCGCTGGCACAGGTCCGCAATTGGACAACCGAAGACGGCGAAAG
CAGACAACAAACCCACTACTTCCACTGCGACCAAATCGGCATCCCGAGAGAGATGACCGATAAGGACGGCAATCTGGTTT
GGTTCGGCGATTATTACGGTTGGGGCAAACTGAGGAGCGAAACGAACGTAACGGGAACTGCTCACCAACCCTTCCGCCTG
CAGAACCAGTATTGCGACCGTGAGACGGGGCTGCATTACAATTTCTTTAGGTATTATGAGCCGAACATCGGGCGGTTTGT
TAATCAGGATCCGATCAAATTAAAGGGTGGGAATAATCTTTATCAATTTGCTTTTAATACTCAAATTTGGATTGATCCAA
AAGGTTTAGTAGCTTTCGCTATTCCAGTGATTGCTCCGGAGTTAGTAGCATTAGGTAAAGCAACTCTTCTTTTATTAGGA
TTAGGTGCGGCTCATGAGGGAAGTAAAGCTATTGGTACTATGATGGCCGCAAATGGCAATCAAGTCGATACAGGAGTTGC
TAATCAAGTCTATGAAAAAATAAATGAATATTCTCGAACTACTGGAAAAAAACCTGATAAATGTGATGTGTTACAAGAAT
TAATTGATTGTGGACAAATATCTGCTAAACAAGCTAAGTCAACACAAAAAGCTTGGGGTTGTCGTCATTCAAGACATTCT
AAGGATAAATGTAACAATAGGAAAAAATGA