Detailed information of effector


Summary

Effector ID EFF18622 experimental
Effector type Tde
Cognate immunity protein IMU17301 experimental
Related T6SS (Type) T6SS00788 experimental (Type i1)
Strain Aeromonas dhakensis strain SSU
Replicon chromosome
Sequence Protein sequence (1546 a.a.); Nucleotide sequence (4638 bp)
Description TseI comprises three distinct regions, an N terminus of unknown function, a middle Tc-toxin domain, and a C-terminal Tox-HNH-EHHH domain. TseI is a T6SS endonuclease effector and only wild-type TseI degraded plasmid DNA, confirming that the conserved H1497 and HFH (1507-1509) are critical residues for the endonuclease activity.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) HMPREF1171_RS04700 (TseI)
Coordinates (Strand) 1021791..1026428 (+)
NCBI ID WP_005299972.1
RefSeq NZ_JH815591
Uniprot ID K1JMA2_9GAMM
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 2.4e-15 420..486
RHS PF03527.16 3.3e-10 1330..1366
Tox-HNH-EHHH PF15657.8 5.8e-09 1472..1532
RHS_repeat PF05593.16 4.4e-06 839..875

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1545 MSNAGQAVFNEVIADYRNVLNAYRKDAESFFLGDMLSMDMEQTIKVGDKTITASSSSKKAQSVVTQCPLSGTLRLVHLFESVRFIPIGNTPYKVEAGKLVRGRFVSEAVAKEGTLDGKGIAEVGKLTPGKSYRVTFYPNVKKSDLDTLFTSYVPVQKDLEAWLTKEWNSEHKAAWARYSGTGGGFGSHALAAASGIGKALVGVWDDLKTIYNLLADPVGNAKKLAAFGVDAAAMAKAGASQMEAAMLVLQDEALLYLYAYALVCWVKMLPPDQQTEFGAQVISSVLIDVIIGVVLTGGAGLAARYGAKAASMAKNSDRVMRLVTSLINLSKKHNLAQHAQQAKKVLVAGAAPLSPAKKADLKLVDGNAKTLVEKGTAAKRRFQGHTEIKQVNKTPDASKQAVTPANRPHQPEANTCKNNCPVSMVTGEELLALQDGELPGLLPFVFGRLYRTSAVAQSCGMGSGWTHALAHRLERHGDTLTWWDEESLATELPLPSAARPMVTNLLSEAAVYLGDEADEVILAKAGSPFLHFTWHGDRGRLTGFSDPYGNRLTVRSDRQGRPAWVENEGGLALRLAYEGDHIMALELQRFDGIAWQPQATLQRYHYDDHGHLVAAENGAGECERYRYRDDGVIVERRLAGGAGFFWEWEGEGKAARAIRHWSDVAGFDVTYGWDDDKGEVTVLNADGSQEVYQHDSQARLVRQQDPDGAITEFAYNDKGQKVLARDPLGAETHYHYDEEGMLALEVAPDGSQTAYDYWDGRVRKVVQGEREWRFEHNPQGDLIARRDPLGNETRYGYTPQGKLCSVVHPDSTRTELVWNRLGQLIEEKGVDGGISRWRYDERGRQIVRQDPRGAITRYEWDATDRLSAVHLPGGGVRRYEYNAYGKVTAQWDELGRETRFEYHPGLHLVSRRINPDGSELKYRYDNAKLLLSEIENEHGEQHRIHYHPNGLVARETGFDGRTTAYRYDLNGRLSEKVEFGKQETELVTRYERDLMGRLLKKSLPDGREIAFEYDGHGQLIRVDDGAWPLAFDYDGAGHLVAEHQGWASSYFRYDAMGRLSHWQLPDGNRLGYHHQHGALGGIDLNGAELTRHQVVGGLELRRQQGALTQQYEYDEQGRLSALRLQRGKQVARERRYGYDRTGNLLRIDDSVQGEQHYRYDPLDRLLEVRGELTERFLHDPAGNLLGESSGGQFDGARTQGNRLLFSGDRHFEYDEFGRLARERRGKGQQLVTRYHYDCQHQLVRAELPDGNTACYDYDAFGRRIRKTVRGAKGEQVTEFLWQANNLIAESCYLLGDDMHRTDEQYRSFIYEPGSFKPLAQLEGEGQEAEVFHYQLDHLGTPLALTRVSGVTAWQVRYRAYGNVWREEIAEVATPLRFQGQYFDAETGLHYNRHRYYQPGTGRFITPDPIGLAGGLNNYQYAPNPTGWVDPLGLSNVPGQCPDASPSRRESFRAAKEAAGIPRSAQYKTHKYVYDKEYENRTVYEFDVHGSKKYIVLHDDDKFGRGPHFHGADDSKGSPMLPGKYKQYPGHFPEIKIGFRKGKIKK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9860 - -



  Protein sequence: 1546 a.a.    .

>EFF18622 NZ_JH815591:1021791-1026428 [Aeromonas dhakensis]
MSNAGQAVFNEVIADYRNVLNAYRKDAESFFLGDMLSMDMEQTIKVGDKTITASSSSKKAQSVVTQCPLSGTLRLVHLFE
SVRFIPIGNTPYKVEAGKLVRGRFVSEAVAKEGTLDGKGIAEVGKLTPGKSYRVTFYPNVKKSDLDTLFTSYVPVQKDLE
AWLTKEWNSEHKAAWARYSGTGGGFGSHALAAASGIGKALVGVWDDLKTIYNLLADPVGNAKKLAAFGVDAAAMAKAGAS
QMEAAMLVLQDEALLYLYAYALVCWVKMLPPDQQTEFGAQVISSVLIDVIIGVVLTGGAGLAARYGAKAASMAKNSDRVM
RLVTSLINLSKKHNLAQHAQQAKKVLVAGAAPLSPAKKADLKLVDGNAKTLVEKGTAAKRRFQGHTEIKQVNKTPDASKQ
AVTPANRPHQPEANTCKNNCPVSMVTGEELLALQDGELPGLLPFVFGRLYRTSAVAQSCGMGSGWTHALAHRLERHGDTL
TWWDEESLATELPLPSAARPMVTNLLSEAAVYLGDEADEVILAKAGSPFLHFTWHGDRGRLTGFSDPYGNRLTVRSDRQG
RPAWVENEGGLALRLAYEGDHIMALELQRFDGIAWQPQATLQRYHYDDHGHLVAAENGAGECERYRYRDDGVIVERRLAG
GAGFFWEWEGEGKAARAIRHWSDVAGFDVTYGWDDDKGEVTVLNADGSQEVYQHDSQARLVRQQDPDGAITEFAYNDKGQ
KVLARDPLGAETHYHYDEEGMLALEVAPDGSQTAYDYWDGRVRKVVQGEREWRFEHNPQGDLIARRDPLGNETRYGYTPQ
GKLCSVVHPDSTRTELVWNRLGQLIEEKGVDGGISRWRYDERGRQIVRQDPRGAITRYEWDATDRLSAVHLPGGGVRRYE
YNAYGKVTAQWDELGRETRFEYHPGLHLVSRRINPDGSELKYRYDNAKLLLSEIENEHGEQHRIHYHPNGLVARETGFDG
RTTAYRYDLNGRLSEKVEFGKQETELVTRYERDLMGRLLKKSLPDGREIAFEYDGHGQLIRVDDGAWPLAFDYDGAGHLV
AEHQGWASSYFRYDAMGRLSHWQLPDGNRLGYHHQHGALGGIDLNGAELTRHQVVGGLELRRQQGALTQQYEYDEQGRLS
ALRLQRGKQVARERRYGYDRTGNLLRIDDSVQGEQHYRYDPLDRLLEVRGELTERFLHDPAGNLLGESSGGQFDGARTQG
NRLLFSGDRHFEYDEFGRLARERRGKGQQLVTRYHYDCQHQLVRAELPDGNTACYDYDAFGRRIRKTVRGAKGEQVTEFL
WQANNLIAESCYLLGDDMHRTDEQYRSFIYEPGSFKPLAQLEGEGQEAEVFHYQLDHLGTPLALTRVSGVTAWQVRYRAY
GNVWREEIAEVATPLRFQGQYFDAETGLHYNRHRYYQPGTGRFITPDPIGLAGGLNNYQYAPNPTGWVDPLGLSNVPGQC
PDASPSRRESFRAAKEAAGIPRSAQYKTHKYVYDKEYENRTVYEFDVHGSKKYIVLHDDDKFGRGPHFHGADDSKGSPML
PGKYKQYPGHFPEIKIGFRKGKIKK*

  Nucleotide sequence: 4638 bp    .

>EFF18622 NZ_JH815591:1021791-1026428 [Aeromonas dhakensis]
ATGAGCAATGCCGGCCAGGCCGTCTTCAACGAAGTGATCGCCGATTATCGCAACGTTCTGAATGCCTATCGCAAGGATGC
TGAGAGTTTCTTTCTGGGCGACATGCTCAGCATGGACATGGAGCAGACCATCAAGGTGGGCGACAAGACCATCACGGCAT
CGTCCAGTAGCAAGAAGGCGCAGTCCGTGGTGACGCAATGCCCGCTGAGCGGCACTTTGCGTCTGGTTCATCTGTTTGAA
TCCGTACGTTTTATTCCCATCGGCAATACCCCGTACAAGGTGGAAGCGGGGAAACTGGTGCGCGGACGATTTGTCAGCGA
GGCGGTAGCCAAGGAGGGAACCCTGGATGGCAAGGGCATTGCCGAGGTCGGTAAGCTGACCCCGGGCAAGTCCTATCGGG
TTACCTTCTACCCCAATGTGAAGAAGAGCGATCTGGATACCTTGTTCACCTCTTATGTTCCCGTTCAAAAAGACCTGGAG
GCATGGCTTACCAAGGAGTGGAACAGTGAGCACAAGGCTGCTTGGGCTCGTTACAGCGGCACTGGTGGTGGGTTTGGCAG
CCATGCTCTGGCGGCAGCAAGCGGTATCGGCAAGGCACTGGTCGGGGTGTGGGACGATCTTAAAACCATCTACAACCTGC
TGGCCGATCCGGTAGGCAATGCCAAAAAGCTGGCCGCCTTCGGCGTGGACGCAGCGGCCATGGCCAAGGCTGGGGCCTCC
CAGATGGAAGCTGCCATGTTGGTACTGCAAGATGAAGCGCTGCTTTATCTTTATGCCTATGCCTTGGTGTGCTGGGTCAA
GATGTTGCCCCCTGATCAGCAAACCGAGTTTGGTGCTCAGGTGATTTCGTCGGTGCTGATTGACGTGATCATCGGTGTGG
TGCTGACCGGAGGAGCTGGCCTCGCGGCGCGCTATGGTGCCAAGGCTGCCTCCATGGCCAAGAACAGTGACCGGGTCATG
CGACTGGTCACCTCCTTGATCAATCTCTCCAAAAAGCACAATTTGGCCCAGCACGCCCAGCAGGCGAAGAAGGTGCTGGT
CGCGGGGGCTGCACCGTTGAGCCCGGCCAAAAAAGCGGATCTCAAGTTGGTCGATGGCAATGCCAAAACGTTGGTGGAAA
AAGGAACGGCGGCCAAACGTCGGTTCCAGGGGCACACCGAGATCAAGCAGGTGAACAAGACTCCGGATGCCTCCAAACAG
GCAGTTACCCCGGCCAACCGGCCCCATCAACCGGAGGCCAACACCTGCAAGAACAACTGCCCGGTCTCCATGGTGACGGG
GGAAGAGTTGCTGGCTCTGCAAGATGGCGAACTGCCGGGCCTGCTTCCCTTTGTCTTCGGGCGCCTCTATCGCACCTCCG
CCGTCGCGCAATCCTGCGGCATGGGGAGCGGCTGGACTCATGCCCTTGCGCACCGGCTTGAACGTCACGGCGATACCCTG
ACCTGGTGGGATGAGGAGTCCCTGGCAACCGAATTGCCGTTGCCATCAGCCGCCAGACCCATGGTGACCAATCTGCTGTC
GGAGGCGGCGGTCTACCTCGGTGACGAGGCTGATGAAGTGATCCTGGCCAAGGCCGGTTCGCCGTTCCTGCATTTTACCT
GGCATGGTGACCGCGGGCGGCTAACCGGTTTTTCCGATCCCTACGGCAATCGACTGACGGTACGCTCTGACCGTCAAGGG
CGCCCCGCCTGGGTTGAAAATGAAGGGGGGCTGGCCCTTCGTCTCGCCTATGAGGGCGACCACATCATGGCGCTCGAGTT
GCAGCGCTTTGATGGCATTGCCTGGCAGCCCCAGGCCACGCTGCAACGCTACCACTACGATGACCATGGTCACCTGGTGG
CGGCCGAGAATGGAGCCGGGGAGTGCGAGCGTTATCGCTATCGCGATGATGGGGTCATTGTGGAGCGCCGCCTGGCTGGC
GGTGCCGGTTTCTTCTGGGAGTGGGAAGGGGAAGGCAAGGCCGCCCGAGCCATCCGTCACTGGAGCGATGTGGCGGGTTT
TGATGTCACCTATGGCTGGGATGATGACAAGGGTGAGGTGACGGTACTCAATGCCGATGGCAGTCAGGAGGTGTATCAGC
ACGACAGCCAGGCACGCCTTGTCCGCCAGCAGGATCCGGATGGTGCGATAACCGAGTTTGCCTACAACGACAAGGGCCAG
AAAGTACTGGCCCGCGACCCGCTGGGGGCCGAGACCCATTATCACTATGACGAAGAGGGGATGTTGGCCCTCGAAGTGGC
TCCCGACGGCAGTCAGACTGCCTATGACTACTGGGATGGCCGGGTTCGCAAGGTAGTGCAGGGGGAGCGTGAATGGCGCT
TTGAGCACAATCCGCAAGGGGATCTGATTGCCAGGCGGGATCCCCTGGGGAACGAAACCCGTTATGGCTATACCCCCCAG
GGCAAGCTGTGCTCTGTGGTTCACCCGGACAGCACCCGCACCGAACTGGTGTGGAACCGCCTTGGCCAGTTGATCGAAGA
AAAAGGGGTCGATGGCGGGATAAGCCGCTGGCGCTATGACGAGCGGGGCCGCCAGATCGTGCGGCAAGACCCGCGTGGCG
CAATCACACGCTATGAATGGGACGCGACAGATCGCCTCAGTGCCGTCCATCTGCCCGGGGGCGGCGTTCGCCGCTATGAG
TACAACGCCTATGGCAAGGTCACGGCGCAGTGGGACGAGCTGGGTCGCGAGACTCGTTTTGAATATCACCCCGGCCTGCA
TCTGGTGAGTCGGCGCATCAACCCAGATGGCAGCGAGCTCAAATACCGCTACGACAACGCCAAGCTCCTTCTCAGCGAGA
TCGAGAACGAGCATGGTGAACAGCATCGTATCCATTACCATCCCAACGGGCTGGTTGCACGGGAAACCGGCTTCGATGGC
CGCACCACCGCCTACCGTTATGATCTCAACGGACGCCTGAGCGAAAAGGTGGAGTTCGGCAAGCAGGAGACCGAACTGGT
CACCCGCTATGAGCGCGACCTCATGGGGCGCCTGCTGAAAAAATCCCTGCCTGATGGTCGCGAGATCGCCTTCGAGTATG
ACGGCCATGGCCAGCTCATCCGGGTCGACGACGGTGCATGGCCCCTGGCATTTGACTACGATGGTGCCGGTCATCTGGTG
GCCGAGCATCAGGGGTGGGCCTCAAGCTATTTCCGATACGATGCCATGGGACGGCTGTCACACTGGCAACTGCCCGATGG
CAACCGGCTTGGCTATCACCATCAGCACGGCGCGCTTGGCGGCATTGATCTCAACGGCGCCGAGCTCACGCGTCATCAGG
TGGTGGGTGGGCTTGAGCTGCGCAGGCAGCAAGGGGCACTGACCCAGCAGTACGAATATGACGAGCAGGGACGCCTCTCG
GCACTGCGTCTGCAGCGGGGCAAGCAGGTCGCCCGCGAGCGGCGCTATGGCTATGACAGAACGGGCAACCTGCTGCGCAT
CGATGACAGCGTGCAGGGGGAGCAGCACTACCGCTACGATCCGCTGGACCGCTTGCTGGAGGTGCGGGGCGAGCTGACCG
AGCGCTTCTTGCATGATCCGGCCGGCAACCTCCTGGGTGAGAGTTCGGGTGGCCAGTTCGATGGGGCCCGCACCCAGGGG
AACCGGCTGCTGTTCAGTGGCGATCGCCACTTCGAGTACGACGAATTTGGCCGATTGGCGCGGGAGCGGCGCGGCAAGGG
TCAGCAACTGGTGACCCGCTATCACTACGACTGCCAGCACCAGCTGGTGAGGGCCGAACTGCCCGATGGCAACACCGCCT
GTTATGACTACGATGCCTTTGGTCGCCGCATTCGCAAGACGGTAAGGGGTGCAAAAGGCGAGCAGGTTACCGAATTCCTG
TGGCAGGCCAACAACCTGATTGCCGAGAGCTGCTATCTGCTCGGTGACGACATGCATCGTACTGACGAGCAGTACCGCAG
CTTTATTTATGAACCCGGCAGTTTCAAACCCCTGGCACAGCTGGAAGGGGAAGGGCAAGAGGCGGAGGTATTTCACTACC
AGCTTGACCACCTGGGCACTCCCTTGGCACTGACCCGCGTCAGCGGAGTCACCGCCTGGCAGGTGCGCTATCGAGCCTAT
GGCAATGTCTGGCGCGAAGAGATCGCCGAGGTGGCAACACCTTTGCGTTTCCAGGGGCAGTATTTTGACGCCGAGACGGG
GCTTCACTATAACCGCCACCGCTACTATCAGCCCGGTACGGGTAGATTTATCACCCCCGACCCGATAGGCTTGGCCGGCG
GGCTCAACAACTACCAGTATGCTCCTAACCCGACTGGCTGGGTGGATCCACTGGGGTTAAGTAATGTGCCGGGACAGTGT
CCCGATGCGTCGCCTTCAAGGCGTGAGAGCTTTCGTGCTGCAAAAGAAGCTGCAGGTATCCCACGTTCAGCGCAATATAA
AACACATAAATATGTTTATGATAAAGAATATGAGAATCGAACTGTCTATGAGTTTGATGTTCATGGAAGCAAAAAATACA
TCGTGCTTCATGATGATGACAAGTTTGGTCGAGGCCCTCATTTTCATGGTGCTGATGATAGTAAAGGTTCTCCCATGCTT
CCCGGCAAGTACAAGCAGTATCCAGGGCATTTTCCTGAAATAAAAATTGGCTTCAGAAAAGGGAAAATAAAAAAATGA