Detailed information of effector


Summary

Effector ID EFF01900 experimental
Effector type Tde
Cognate immunity protein IMU00384 experimental
Related T6SS (Type) T6SS01301 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (175 a.a.); Nucleotide sequence (525 bp)
Description Ectopic expression of TseTBg3 protein inhibited the growth, while co-expression of the cognate immunity (TsiTBg3) protein failed to protect the cells from effector mediated killing.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACI79_RS22680 (TseTBg3)
Coordinates (Strand) 197941..198465 (-)
NCBI ID 836690956
GenBank LEKY01000067
Uniprot ID UPI00064A2E1C
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-REase-5 PF15648.8 6.6e-28 59..152

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-174 MGGSVAAGVASIGGSTARTKDDAQAASRTIVDSRESCKSCPPATSGTKVRNNHGVNWPAYEYQARVTGFAFDTEACRWSDEWKWLGNDYDGFRPGECLLQEAKGNYDQFLDGSIPGADEFFMGFRAMMDIAAIRSRRVQANPPTRLRYYFQGPLTYQKLSAGLSKLRVESEYFP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
SP(Sec/SPI) 0.4890 pos: 25-26. AQA-AS. MGGSVAAGVASIGGSTARTKDDAQA



  Protein sequence: 175 a.a.    .

>EFF01900 LEKY01000067:c198465-197941 [Burkholderia gladioli]
MGGSVAAGVASIGGSTARTKDDAQAASRTIVDSRESCKSCPPATSGTKVRNNHGVNWPAYEYQARVTGFAFDTEACRWSD
EWKWLGNDYDGFRPGECLLQEAKGNYDQFLDGSIPGADEFFMGFRAMMDIAAIRSRRVQANPPTRLRYYFQGPLTYQKLS
AGLSKLRVESEYFP*

  Nucleotide sequence: 525 bp    .

>EFF01900 LEKY01000067:c198465-197941 [Burkholderia gladioli]
TTGGGCGGCTCGGTGGCGGCAGGCGTGGCTAGTATTGGGGGGAGTACGGCGCGAACGAAGGACGATGCACAAGCCGCGTC
AAGGACGATCGTCGACTCTCGGGAATCCTGCAAATCGTGTCCGCCCGCGACGAGCGGCACGAAGGTCCGAAATAATCACG
GCGTGAATTGGCCGGCCTATGAATATCAGGCACGAGTGACCGGCTTCGCCTTCGACACGGAAGCCTGCCGCTGGAGCGAC
GAGTGGAAGTGGCTGGGGAACGACTACGATGGTTTCAGGCCGGGGGAGTGCCTGCTGCAGGAGGCGAAGGGGAACTATGA
TCAATTCCTGGACGGGTCGATTCCCGGCGCGGATGAATTTTTCATGGGTTTCCGCGCAATGATGGACATTGCAGCGATCC
GCTCGCGCCGTGTGCAAGCGAACCCGCCTACGAGGCTGCGGTACTACTTTCAAGGACCTTTGACTTATCAGAAACTGTCC
GCCGGCCTGAGTAAGCTCCGTGTTGAATCTGAATACTTTCCTTGA