Detailed information of effector


Summary

Effector ID EFF01895 experimental
Effector type Tde
Cognate immunity protein IMU00385 experimental
Related T6SS (Type) T6SS01301 experimental (Type i3)
Strain Burkholderia gladioli NGJ1
Replicon chromosome
Sequence Protein sequence (239 a.a.); Nucleotide sequence (717 bp)
Description The TseTBg effector proteins of NGJ1 harbor potent DNase and RNase activity. Treatment of TseTBg1/TseTBg2 proteins completely degraded the pHM1 plasmid (isolated from E. coli), but failed to degrade it when isolated from NGJ1. And plasmid (pET28a) isolated from Dam-expressing E. coli cells was not degraded by either of TseTBg1/TseTBg2 proteins. However, plasmid isolated from cells that do not express Dam protein was completely degraded by both of them.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AC179_RS29610 (Hcp-2)
Coordinates (Strand) 22675..23391 (-)
NCBI ID 836692495
GenBank LEKY01000082
Uniprot ID UPI00064A5ED4
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Imm52 PF15579.8 2.1e-31 132..232

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-238 MNIIASFRDPSLLADDFAGMLARISPIAAKLATYDASLRAENWRLKGDTLEEAMLYQVYDANGESTPAALAVLREAFRGEHAFTYAALWDGNRDASKGASISCHIADKTIPDRLSITIRGPAWQDYRAVADLVAKIVEVFGPLLVDVSDEKYVLKQVFDDKPGVGWMLYLPHRITTQQVPEARALIPIPSAGRKQTGTIIVSVVDEAFSADNPEHVEIANRIEIRLVDHDLLPTYLSL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9742 - -



  Protein sequence: 239 a.a.    .

>EFF01895 LEKY01000082:c23391-22675 [Burkholderia gladioli]
MNIIASFRDPSLLADDFAGMLARISPIAAKLATYDASLRAENWRLKGDTLEEAMLYQVYDANGESTPAALAVLREAFRGE
HAFTYAALWDGNRDASKGASISCHIADKTIPDRLSITIRGPAWQDYRAVADLVAKIVEVFGPLLVDVSDEKYVLKQVFDD
KPGVGWMLYLPHRITTQQVPEARALIPIPSAGRKQTGTIIVSVVDEAFSADNPEHVEIANRIEIRLVDHDLLPTYLSL*

  Nucleotide sequence: 717 bp    .

>EFF01895 LEKY01000082:c23391-22675 [Burkholderia gladioli]
ATGAACATCATCGCAAGCTTTCGCGATCCATCACTCCTGGCAGACGACTTCGCGGGCATGCTTGCGCGAATTTCACCTAT
CGCCGCAAAACTTGCCACCTACGATGCATCCCTTCGCGCAGAGAACTGGCGCCTGAAAGGAGATACGCTGGAAGAAGCGA
TGCTCTACCAGGTTTACGACGCCAATGGCGAGTCGACACCCGCTGCCCTGGCGGTGCTTCGCGAGGCATTTCGCGGTGAG
CACGCCTTCACCTATGCCGCCTTATGGGATGGAAACAGGGATGCCAGCAAGGGCGCCTCGATTTCCTGCCACATAGCCGA
CAAAACCATTCCCGATAGGCTGTCGATCACTATTCGCGGGCCAGCGTGGCAAGACTATCGGGCGGTTGCGGATCTCGTCG
CGAAAATCGTCGAGGTTTTCGGGCCGCTGCTCGTCGACGTGTCCGATGAGAAATACGTACTCAAGCAAGTTTTCGACGAC
AAACCCGGCGTCGGCTGGATGCTCTACTTGCCGCACCGAATCACCACGCAACAGGTTCCCGAAGCAAGGGCACTCATCCC
CATCCCATCCGCCGGCCGCAAGCAAACCGGCACGATCATCGTCAGCGTCGTGGATGAAGCGTTCTCAGCCGACAATCCCG
AGCATGTCGAGATCGCGAACCGCATCGAGATTCGACTCGTCGACCACGACCTGCTGCCGACCTATCTCAGCTTATAA