Detailed information of effector


Summary

Effector ID EFF01890 experimental
Effector type Tne
Cognate immunity protein IMU00381 experimental
Related T6SS (Type) T6SS01297 experimental (Type i4b)
Strain Pseudomonas sp. JY-Q
Replicon chromosome
Sequence Protein sequence (311 a.a.); Nucleotide sequence (933 bp)
Description The Ntox46 domain of TseN can rapidly remove NAD1 and TseN is crucial to maintain JY-Q homeostasis and to neutralize ROS accumulation in response to stresses driven by nicotine metabolism.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) AA098_13375 (TseN)
Coordinates (Strand) 2938691..2939623 (-)
NCBI ID 939342945
RefSeq NZ_CP011525
Uniprot ID UPI0006D3AF54
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ntox46 PF15538.8 9.6e-97 146..302

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-310 MTTAWFAEDGLKPAGLDPSGGSAAQAQERVERAARQLARGQEQWVLLLLTAIVTYLTRGQMKAGVMSSMESIAARSARLQAEISNKQLAAWLAKNEQKLLAQPELQPKEATPISRAQAQPEPLRPLPDRPPIAQAPDKPGLTEVSRREYLNKKFARTGNLAQDINIRGNQETAVNFFKSQGYKPADYEGYMNGLDFTQPVFTETINRGKTLWQFQVPGGRQGMWYSPTPDVVPGQLGINPLGQIYKTETIVPKIVNVYQSTEKVTLLRSTSAPVLDTWSVPSQPYNAIGGARQMTSGQRELFKLITPGAL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9892 - -



  Protein sequence: 311 a.a.    .

>EFF01890 NZ_CP011525:c2939623-2938691 [Pseudomonas sp. JY-Q]
MTTAWFAEDGLKPAGLDPSGGSAAQAQERVERAARQLARGQEQWVLLLLTAIVTYLTRGQMKAGVMSSMESIAARSARLQ
AEISNKQLAAWLAKNEQKLLAQPELQPKEATPISRAQAQPEPLRPLPDRPPIAQAPDKPGLTEVSRREYLNKKFARTGNL
AQDINIRGNQETAVNFFKSQGYKPADYEGYMNGLDFTQPVFTETINRGKTLWQFQVPGGRQGMWYSPTPDVVPGQLGINP
LGQIYKTETIVPKIVNVYQSTEKVTLLRSTSAPVLDTWSVPSQPYNAIGGARQMTSGQRELFKLITPGAL*

  Nucleotide sequence: 933 bp    .

>EFF01890 NZ_CP011525:c2939623-2938691 [Pseudomonas sp. JY-Q]
ATGACCACGGCCTGGTTCGCCGAGGATGGCCTCAAGCCCGCTGGCCTGGACCCGAGCGGCGGTTCCGCGGCGCAGGCCCA
GGAGCGTGTCGAGCGTGCTGCACGCCAGCTTGCTCGCGGGCAGGAGCAGTGGGTGTTGCTGTTACTGACAGCCATCGTCA
CCTACCTTACTCGGGGCCAGATGAAGGCCGGCGTCATGAGCAGCATGGAAAGCATTGCCGCCCGGAGCGCTCGGCTGCAG
GCCGAGATCTCCAACAAGCAGCTGGCAGCCTGGTTGGCGAAGAATGAGCAGAAACTGTTGGCGCAGCCGGAGTTGCAGCC
CAAAGAGGCCACACCGATCTCTCGTGCACAAGCGCAACCGGAGCCATTGCGACCACTACCCGATCGACCACCCATTGCTC
AGGCACCGGATAAGCCAGGCTTAACGGAAGTTTCCCGTAGGGAGTACCTGAACAAGAAGTTCGCTCGAACGGGTAACTTG
GCACAGGACATCAACATACGAGGCAACCAGGAAACTGCTGTAAACTTCTTCAAGTCACAGGGCTATAAGCCTGCCGACTA
CGAAGGCTACATGAACGGCTTGGACTTCACTCAACCAGTCTTCACGGAAACAATCAACCGGGGCAAGACACTTTGGCAAT
TCCAGGTGCCCGGCGGCCGGCAAGGCATGTGGTACTCTCCTACCCCTGACGTGGTGCCAGGGCAACTGGGGATCAACCCG
CTTGGCCAGATCTACAAAACGGAAACCATCGTGCCCAAGATCGTGAACGTCTATCAGAGCACTGAGAAGGTCACGCTGCT
GAGGAGTACCTCGGCACCGGTACTGGATACCTGGTCCGTTCCTTCCCAACCCTATAACGCCATTGGCGGTGCTCGGCAGA
TGACCTCTGGCCAACGCGAGCTCTTCAAACTGATAACACCAGGTGCATTATGA