Detailed information of effector


Summary

Effector ID EFF01888 experimental
Effector type Tpe
Cognate immunity protein IMU17302 experimental
Related T6SS (Type) T6SS00788 experimental (Type i1)
Strain Aeromonas dhakensis strain SSU
Replicon chromosome
Sequence Protein sequence (208 a.a.); Nucleotide sequence (624 bp)
Description Wild-type TseP reduced the optical density of cell wall to the baseline level within 5 min of treatment while TsePE663A had no effect on optical density showed evidence of the lysozyme-like activity of TseP cleaving the peptidoglycan chain.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) HMPREF1171_RS04800 (TseP)
Coordinates (Strand) 1054604..1055227 (+)
NCBI ID WP_029305891.1
RefSeq NZ_JH815591
Uniprot ID UPI0004932A7D
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-207 MKEERAMAHFLSQVGHESNFKPVSENLRYSPKGMRKIFGCKGGSKNYDPILDDAKEGRLRPKLWTHESDYAFNPVALGNYVYANRPGSKNGDESSGDGYKYRGRGLIQITHKDAYIKFTEAHNAANPSDQKDFLASPDDILTLRYATSSAYFFWFIYKKSFNLHSTACTGTVKEVTKIVNGGYAGYADRLKRFNAVAAVIGIDGARE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9613 - -



  Protein sequence: 208 a.a.    .

>EFF01888 NZ_JH815591:1054604-1055227 [Aeromonas dhakensis]
MKEERAMAHFLSQVGHESNFKPVSENLRYSPKGMRKIFGCKGGSKNYDPILDDAKEGRLRPKLWTHESDYAFNPVALGNY
VYANRPGSKNGDESSGDGYKYRGRGLIQITHKDAYIKFTEAHNAANPSDQKDFLASPDDILTLRYATSSAYFFWFIYKKS
FNLHSTACTGTVKEVTKIVNGGYAGYADRLKRFNAVAAVIGIDGARE*

  Nucleotide sequence: 624 bp    .

>EFF01888 NZ_JH815591:1054604-1055227 [Aeromonas dhakensis]
ATGAAAGAAGAAAGAGCCATGGCCCATTTCTTATCCCAAGTAGGTCATGAGTCAAACTTTAAACCTGTAAGTGAGAATCT
TCGTTATAGTCCTAAAGGTATGCGGAAAATTTTTGGTTGTAAAGGGGGATCTAAAAACTACGATCCTATATTAGATGATG
CAAAGGAGGGAAGGTTAAGACCGAAGTTGTGGACTCATGAGAGCGATTATGCATTCAATCCTGTGGCTTTAGGAAACTAT
GTCTACGCCAACAGACCGGGAAGTAAAAACGGCGATGAGAGCTCTGGTGATGGATATAAATATCGAGGCAGAGGGTTGAT
TCAAATAACACACAAGGATGCATACATAAAATTCACCGAAGCTCATAATGCAGCAAACCCCTCAGACCAAAAAGACTTTT
TGGCTTCACCGGATGACATACTGACACTTCGATATGCTACATCATCTGCATACTTTTTTTGGTTTATATACAAAAAAAGC
TTTAATTTGCATTCAACTGCATGCACAGGGACAGTCAAAGAGGTTACAAAAATTGTAAATGGAGGCTATGCTGGTTATGC
AGATAGATTAAAGAGGTTTAATGCGGTTGCTGCAGTTATTGGTATTGATGGGGCGAGAGAGTGA