Detailed information of effector


Summary

Effector ID EFF01885 experimental
Effector type Tse
Cognate immunity protein IMU00365 experimental
Related T6SS (Type) T6SS00907 experimental (Type iii)
Strain Bacteroides fragilis NCTC 9343
Replicon chromosome
Sequence Protein sequence (289 a.a.); Nucleotide sequence (867 bp)
Description In- frame deletion of the candidate E/I pairs from the wild-type strain, and constitutive expression of the candidate immunity genes in a tssC recipient strain lacking both E/I pairs, confirmed that each immunity protein confers protection against T6SS-mediated cell killing in an effector-specific manner.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BF9343_1937 (bte1)
Coordinates (Strand) 2364119..2364985 (-)
NCBI ID 60492942
RefSeq NC_003228
Uniprot ID Q5LDT7_BACFN
KEGG ID bfs:BF9343_1937
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-288 MGKEIEIKKLPEFEAMVNAGNTTYTGLVEGIGYVYWTTETLYFIRTNPEQLWAIPKYQQIPFPYFQRKDAIIETKTLHTLHVLSKDELLKLDYDAYYAFYGIVEEMLKFIHRADAIKSYCEIPLPIIKSKGALKGNDARNGILSLGSQINDQIGAPLDAANMLMDNKHIGKIGDGLSLISIIDEVGNGEYWSAAGDILLFAAGKTKLSPYMTVISLGTWMYETDLMQWRLACINYSDYKKTLIKYRELQKKFESGDKSVEEKMNECHKILNSHYIEMQKNLGNLGVKF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9881 - -



  Protein sequence: 289 a.a.    .

>EFF01885 NC_003228:c2364985-2364119 [Bacteroides fragilis NCTC 9343]
MGKEIEIKKLPEFEAMVNAGNTTYTGLVEGIGYVYWTTETLYFIRTNPEQLWAIPKYQQIPFPYFQRKDAIIETKTLHTL
HVLSKDELLKLDYDAYYAFYGIVEEMLKFIHRADAIKSYCEIPLPIIKSKGALKGNDARNGILSLGSQINDQIGAPLDAA
NMLMDNKHIGKIGDGLSLISIIDEVGNGEYWSAAGDILLFAAGKTKLSPYMTVISLGTWMYETDLMQWRLACINYSDYKK
TLIKYRELQKKFESGDKSVEEKMNECHKILNSHYIEMQKNLGNLGVKF*

  Nucleotide sequence: 867 bp    .

>EFF01885 NC_003228:c2364985-2364119 [Bacteroides fragilis NCTC 9343]
ATGGGTAAGGAAATAGAAATAAAGAAATTGCCAGAGTTCGAGGCTATGGTGAATGCCGGTAATACGACCTATACGGGATT
GGTAGAAGGCATCGGGTATGTGTATTGGACAACAGAAACCCTATATTTTATCCGCACTAATCCAGAACAATTATGGGCGA
TTCCAAAATATCAGCAAATACCTTTCCCCTATTTTCAAAGGAAAGATGCAATCATTGAGACCAAAACATTACATACACTC
CATGTCTTGTCAAAAGATGAACTGTTGAAATTGGATTACGATGCCTATTATGCATTTTATGGTATCGTGGAGGAGATGCT
AAAATTTATTCATCGGGCGGATGCTATTAAAAGTTATTGTGAAATACCTCTTCCCATAATAAAATCCAAAGGAGCACTAA
AGGGAAATGACGCAAGAAATGGGATACTATCATTAGGTAGTCAAATAAATGACCAAATCGGAGCTCCCCTTGATGCAGCG
AATATGCTAATGGATAATAAACATATAGGCAAAATTGGAGATGGATTGTCGCTTATTTCTATTATAGATGAGGTAGGTAA
TGGTGAATATTGGTCAGCTGCCGGAGACATTTTACTGTTTGCAGCCGGAAAAACAAAATTAAGTCCCTATATGACTGTCA
TAAGTTTAGGCACATGGATGTATGAGACGGACTTGATGCAATGGAGATTAGCATGTATAAATTATAGCGATTACAAAAAA
ACACTAATAAAATATCGAGAATTACAAAAAAAATTTGAAAGTGGAGACAAATCTGTAGAGGAAAAGATGAATGAATGTCA
CAAAATACTGAATTCACATTATATAGAGATGCAAAAAAATTTAGGTAATCTAGGAGTTAAATTCTAA