Detailed information of effector


Summary

Effector ID EFF01872 experimental
Effector type Tle
Cognate immunity protein IMU00375 experimental
Related T6SS (Type) T6SS00395 experimental (Type i3)
Strain Enterobacter cloacae subsp. cloacae ATCC 13047
Replicon chromosome
Sequence Protein sequence (473 a.a.); Nucleotide sequence (1419 bp)
Description Wild-type cells outcompeting Δtle Δtli mutants almost 103-fold. Competitive fitness is restored to these latter targets when complemented with the wild-type tli gene.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECL_01553 (Tle)
Coordinates (Strand) 1576408..1577826 (+)
NCBI ID 502861217
RefSeq NC_014121
Uniprot ID A0A0M7ENE2_ENTCL, A0A0H3CIY9_ENTCC
KEGG ID enc:ECL_01553
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-472 MYNIKFVYLFSENVSPALFAKIIHPSVAGQWIMSVPDNSLRSLFTRYDLLHSITGANPYQSGRDIRKLIVQDLDMGRVVAIDESYRNWSSVTEIFYINADGRLQAASLDGLGWYPVSTIVDRYETMVRTYGSRPAPTVLPKQVVKSKAAQMPDEPTPGKDGKTYAAQLENMTKAERWQARKDLIAKGSNSLYPDAQIAAKRLAANNIAVEKAKLAENVYKTVNPLEATPGVPEGWKDISNDAGALKKYGLDKEVLFDHADTPDFLARVYQPDSAVFGSDMNPTIVFRGSRQPEFFPTKNMADWINNGAQGLGMESDYYKRAVRLGSRLAKSVSKIDIAGHSLGGGLASATSIASGQAGWTFNAAGLHSTTVEKYGGSLLGEADNIQAYRVEGELLTKIQEVNLAEDYKMLKGHIPTLIAKEEISAIMPNAAGVVHDLPGGTGGPLDRHGIGQAIDCIEQQKDEDISIIRSRA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9422 - -



  Protein sequence: 473 a.a.    .

>EFF01872 NC_014121:1576408-1577826 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MYNIKFVYLFSENVSPALFAKIIHPSVAGQWIMSVPDNSLRSLFTRYDLLHSITGANPYQSGRDIRKLIVQDLDMGRVVA
IDESYRNWSSVTEIFYINADGRLQAASLDGLGWYPVSTIVDRYETMVRTYGSRPAPTVLPKQVVKSKAAQMPDEPTPGKD
GKTYAAQLENMTKAERWQARKDLIAKGSNSLYPDAQIAAKRLAANNIAVEKAKLAENVYKTVNPLEATPGVPEGWKDISN
DAGALKKYGLDKEVLFDHADTPDFLARVYQPDSAVFGSDMNPTIVFRGSRQPEFFPTKNMADWINNGAQGLGMESDYYKR
AVRLGSRLAKSVSKIDIAGHSLGGGLASATSIASGQAGWTFNAAGLHSTTVEKYGGSLLGEADNIQAYRVEGELLTKIQE
VNLAEDYKMLKGHIPTLIAKEEISAIMPNAAGVVHDLPGGTGGPLDRHGIGQAIDCIEQQKDEDISIIRSRA*

  Nucleotide sequence: 1419 bp    .

>EFF01872 NC_014121:1576408-1577826 [Enterobacter cloacae subsp. cloacae ATCC 13047]
ATGTACAACATAAAATTTGTCTATCTTTTCAGCGAGAACGTCTCGCCCGCGCTTTTTGCGAAAATTATCCACCCGTCCGT
TGCCGGGCAGTGGATTATGTCGGTGCCCGACAATTCGCTGCGCTCGCTGTTTACACGTTACGACTTGCTGCACTCCATCA
CTGGCGCGAATCCTTACCAGTCCGGGCGCGATATCCGTAAGCTGATTGTGCAGGATCTCGACATGGGCAGAGTGGTGGCG
ATCGACGAGAGCTATCGTAACTGGTCGTCAGTGACGGAGATATTTTATATCAATGCTGATGGCCGTCTGCAGGCTGCCTC
GCTGGACGGTCTGGGCTGGTACCCGGTGAGTACAATTGTCGACCGCTACGAAACCATGGTGCGAACCTATGGCTCCCGCC
CTGCGCCAACGGTGCTGCCGAAACAGGTAGTCAAATCCAAAGCGGCACAGATGCCGGATGAGCCGACGCCGGGCAAAGAC
GGTAAAACCTATGCGGCACAGCTGGAGAATATGACCAAAGCTGAACGCTGGCAGGCGCGTAAGGATCTGATTGCGAAGGG
GAGTAATAGCCTCTATCCGGATGCGCAAATCGCGGCTAAGCGGCTGGCGGCGAATAATATCGCGGTTGAGAAAGCGAAGC
TGGCAGAGAATGTGTATAAGACCGTGAACCCGCTTGAGGCCACGCCGGGAGTACCGGAGGGGTGGAAGGATATCAGTAAT
GATGCGGGTGCTTTGAAGAAATATGGTCTGGATAAAGAAGTTCTTTTTGACCATGCCGATACGCCTGACTTCCTGGCGCG
AGTTTATCAACCTGATTCTGCGGTTTTTGGCAGTGACATGAATCCAACAATCGTGTTCAGAGGATCAAGGCAACCTGAGT
TTTTTCCCACGAAGAACATGGCTGACTGGATAAACAATGGTGCTCAAGGTTTAGGTATGGAGTCGGATTATTATAAGCGG
GCAGTACGCTTGGGATCACGTCTGGCTAAATCGGTATCTAAAATCGATATTGCAGGCCACTCTCTGGGTGGTGGGTTGGC
CTCTGCTACCTCTATCGCAAGCGGTCAGGCTGGATGGACATTCAATGCGGCTGGTCTGCATTCAACCACTGTTGAAAAAT
ACGGTGGAAGCTTGCTGGGTGAGGCGGATAATATTCAGGCTTATCGTGTTGAAGGTGAATTGCTGACAAAAATCCAGGAA
GTTAATCTGGCGGAAGACTATAAAATGTTGAAAGGCCACATCCCAACGCTTATAGCCAAAGAAGAAATCTCTGCCATTAT
GCCTAATGCTGCTGGAGTTGTTCACGATCTTCCCGGCGGGACAGGCGGTCCATTGGACCGCCATGGCATTGGTCAGGCAA
TAGATTGCATAGAACAGCAAAAGGATGAAGACATTTCAATTATTAGGAGTCGTGCATGA