Detailed information of effector


Summary

Effector ID EFF01870 experimental
Effector type Tae
Cognate immunity protein IMU00360 experimental
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (256 a.a.); Nucleotide sequence (768 bp)
Description AmpDh3 secretion is under the control of H2-T6SS and it is a toxin with catalytic activity and catalysis is required for its antibacterial activity
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0807 (AmpDh3)
Coordinates (Strand) 884799..885566 (+)
NCBI ID 15596004
RefSeq NC_002516
Uniprot ID Q9I5D1_PSEAE
KEGG ID pae:PA0807
PDB ID 4BXD, 4BXE, 4BXJ

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Amidase_2 PF01510.27 1.8e-24 17..159

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-20 MLTIDYNSYRTTTPYGKRVR
Transmembrane helix 21-43 FLVLHYTALDFAASVKALTTGAA
Outside 44-255 SAHYLIPAPHDPSYKAAGFKGQRIFNLVAEEDRAWHAGVSGWARRDNLNDTSIGIEIVNLARDDDGVFTFPDYERSQINALKQLAKNILQRYPDMTPKNVVGHSDIAVGRKSDPGPKLPWKELYEAGIGAWYDDATRDRYREGFERDGLPPRADLLEAFRLYGYALPATVDDAYFASLLRAFQMHFRPENYDGALDVETAAILYALNEKYPA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7952 - -



  Protein sequence: 256 a.a.    .

>EFF01870 NC_002516:884799-885566 [Pseudomonas aeruginosa PAO1]
MLTIDYNSYRTTTPYGKRVRFLVLHYTALDFAASVKALTTGAASAHYLIPAPHDPSYKAAGFKGQRIFNLVAEEDRAWHA
GVSGWARRDNLNDTSIGIEIVNLARDDDGVFTFPDYERSQINALKQLAKNILQRYPDMTPKNVVGHSDIAVGRKSDPGPK
LPWKELYEAGIGAWYDDATRDRYREGFERDGLPPRADLLEAFRLYGYALPATVDDAYFASLLRAFQMHFRPENYDGALDV
ETAAILYALNEKYPA*

  Nucleotide sequence: 768 bp    .

>EFF01870 NC_002516:884799-885566 [Pseudomonas aeruginosa PAO1]
ATGCTGACCATCGACTACAACAGCTATCGCACCACTACCCCCTACGGCAAACGCGTGCGCTTCCTGGTGCTGCACTACAC
CGCGCTCGACTTCGCCGCCTCGGTCAAGGCGCTGACCACCGGCGCCGCCAGCGCCCACTACCTGATCCCGGCGCCGCACG
ACCCCAGCTACAAGGCCGCCGGCTTCAAGGGCCAGCGCATCTTCAACCTGGTCGCCGAGGAAGACCGCGCCTGGCACGCC
GGCGTCAGCGGCTGGGCGCGCCGCGACAACCTCAACGACACCTCCATCGGCATCGAGATCGTCAACCTCGCCCGCGACGA
CGACGGCGTGTTCACCTTCCCCGACTACGAGCGCTCGCAGATCAACGCACTCAAGCAACTGGCGAAGAACATCCTGCAGC
GCTACCCGGACATGACCCCGAAGAACGTGGTCGGCCACTCCGACATCGCCGTCGGGCGCAAGTCCGACCCGGGTCCGAAG
CTGCCCTGGAAGGAACTCTACGAGGCCGGTATCGGCGCCTGGTATGACGACGCCACCCGCGATCGCTATCGCGAAGGCTT
CGAGCGCGACGGCCTGCCGCCGCGCGCCGACCTGCTGGAGGCGTTCCGCCTGTACGGCTATGCGCTGCCGGCGACGGTCG
ACGACGCCTACTTCGCCAGCCTGCTGCGCGCCTTCCAGATGCATTTCCGCCCGGAGAACTACGACGGCGCGCTGGATGTG
GAGACGGCGGCGATCCTCTACGCTCTGAACGAGAAATACCCGGCCTGA