Detailed information of effector


Summary

Effector ID EFF01858 experimental
Effector type -
Cognate immunity protein IMU00380 experimental
Related T6SS (Type) T6SS01242 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 1D1108
Replicon chromosome
Sequence Protein sequence (379 a.a.); Nucleotide sequence (1137 bp)
Description The direct expression of E11 in the parental 1D1108 strain caused a substantial reduction in growth. Coexpression of I11_1, the gene immediately 3' to E11, led to a partial restoration in growth. I11_2 and I11_3, more distal to E11, showed no measurable protective effect.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At1D1108_RS23280 (E11)
Coordinates (Strand) 2072000..2073136 (+)
NCBI ID 1421606991
RefSeq NZ_CP032922
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 2.6e-34 23..125

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-378 MKETIRINGITLCHKNSNGYVRSTLPDVCLTPPKPVPVPYTNTAFARDLADGTTTVFSHGGAMNGVRGSRFAKSIGDEPGSSGGVKSGTHLHEATFLSWSPNVFMQGRAVTRLTDKMLLNKGNTVSVGGYKTDLPEGHPERYLCEVGCRCYALHRPRNSVTEGLEWMDQVLPRDDEASPGRYQRCVDATIQAQYPNTVLGGSMPVGDPRTNYGYISELGFWDPNNPNNQFPDKPPGNVILQGEEHDIPKVPRRAPWGGTRWFNVRGSRWLDVVKVENGQMTHMYDMKFPGDKFPNDPTKNAAYEAIALRHRARYREFVVLDECDNCEESVRQREQERQWEAEERWRQLKKGLENGPPIWLPLPGPRLPGGRRPPIPSW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8814 - -



  Protein sequence: 379 a.a.    .

>EFF01858 NZ_CP032922:2072000-2073136 [Agrobacterium tumefaciens]
MKETIRINGITLCHKNSNGYVRSTLPDVCLTPPKPVPVPYTNTAFARDLADGTTTVFSHGGAMNGVRGSRFAKSIGDEPG
SSGGVKSGTHLHEATFLSWSPNVFMQGRAVTRLTDKMLLNKGNTVSVGGYKTDLPEGHPERYLCEVGCRCYALHRPRNSV
TEGLEWMDQVLPRDDEASPGRYQRCVDATIQAQYPNTVLGGSMPVGDPRTNYGYISELGFWDPNNPNNQFPDKPPGNVIL
QGEEHDIPKVPRRAPWGGTRWFNVRGSRWLDVVKVENGQMTHMYDMKFPGDKFPNDPTKNAAYEAIALRHRARYREFVVL
DECDNCEESVRQREQERQWEAEERWRQLKKGLENGPPIWLPLPGPRLPGGRRPPIPSW*

  Nucleotide sequence: 1137 bp    .

>EFF01858 NZ_CP032922:2072000-2073136 [Agrobacterium tumefaciens]
ATGAAGGAAACAATCCGCATCAATGGGATTACACTCTGCCACAAAAACTCGAATGGCTATGTTCGCTCGACGTTGCCGGA
TGTATGCCTGACCCCGCCCAAGCCAGTGCCCGTGCCATACACGAATACCGCATTTGCCCGCGACCTTGCCGACGGTACCA
CCACGGTGTTTTCGCATGGCGGGGCGATGAACGGCGTGCGCGGCTCCCGGTTCGCCAAATCGATCGGTGACGAGCCCGGT
TCCTCGGGAGGGGTCAAATCGGGGACACATCTGCATGAGGCGACGTTCTTGTCCTGGTCTCCCAATGTGTTCATGCAAGG
CCGCGCAGTAACGCGTCTTACCGACAAGATGCTCCTCAACAAGGGAAACACCGTCTCGGTCGGTGGCTACAAGACCGACC
TGCCTGAAGGCCATCCTGAACGTTATCTCTGCGAGGTGGGCTGCCGCTGTTATGCGCTGCATCGGCCCAGAAATAGCGTT
ACCGAGGGGCTTGAATGGATGGATCAGGTTTTGCCGCGCGACGACGAGGCAAGCCCGGGTCGCTATCAACGCTGTGTCGA
TGCAACGATCCAGGCGCAATATCCAAACACGGTCCTTGGCGGCAGCATGCCGGTCGGCGATCCGCGCACCAATTACGGCT
ATATTTCCGAGCTTGGATTCTGGGACCCGAACAATCCGAACAATCAGTTCCCGGACAAACCGCCCGGCAATGTCATCCTG
CAGGGAGAAGAACACGACATTCCCAAGGTTCCCCGCAGGGCGCCCTGGGGCGGTACGCGATGGTTCAATGTGCGTGGCTC
GCGCTGGCTCGATGTGGTGAAAGTCGAGAACGGCCAGATGACACATATGTACGATATGAAGTTTCCGGGGGACAAGTTTC
CGAATGATCCCACGAAGAATGCCGCATATGAGGCTATCGCATTGCGTCACAGGGCTAGATACAGGGAATTCGTGGTGCTG
GATGAATGTGACAATTGCGAGGAATCCGTGAGGCAGCGCGAACAGGAACGTCAATGGGAGGCCGAAGAACGATGGCGACA
GCTCAAAAAAGGCCTTGAGAATGGCCCGCCGATCTGGCTTCCGTTGCCAGGCCCGAGGCTCCCTGGTGGACGTCGACCTC
CGATACCAAGCTGGTAG