Detailed information of effector


Summary

Effector ID EFF01855 experimental
Effector type Tde
Cognate immunity protein IMU00379 experimental
Related T6SS (Type) T6SS01241 experimental (Type i5)
Strain Agrobacterium tumefaciens strain 12D1
Replicon chromosome
Sequence Protein sequence (308 a.a.); Nucleotide sequence (924 bp)
Description E4 and EI4 of 12D1 were cloned and expressed directly and the E4 gene led to a 40% reduction in the growth relative to E. coli carrying an empty vector. The relative growth of E. coli could be rescued by coexpressing the I4 gene. When E. coli strains were not induced for expression, their relative growth showed only slight differences relative to a strain carrying an empty vector.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) At12D1_RS23110 (E4)
Coordinates (Strand) 1742752..1743675 (+)
NCBI ID 489600126
RefSeq NZ_CP033032
Uniprot ID A0A1S7S9P8_RHIRD
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
WHH PF14414.8 7.2e-13 263..303

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-307 MSQHLDDLVNVPDTRELELARRDLDMLNQRYTEIAKEAGWLAASSIPVVGGVVDVASAIGNAWTGNWADAGLDLVGLVPVWGDGAKAAAKGTKIARYAEKLMSQVAAAQRKVKALEDHVRKSAAASKYWASKRGEAYRKLQEDLRKCNTKACRQKKIDEYKNGGKYKNIPREGKWSGEPGNSKWSPEPGTPADKALKEYGQDGVQYRNGKPDFSPFSQKGPDGKPIEARIPDMQGNHAARNGDFGQARTAMKERYGSWNASKMEDGYTWHHNEDTSTMQLVDERIHAVKSGGGAHTGGASAVKDPAY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7799 - -



  Protein sequence: 308 a.a.    .

>EFF01855 NZ_CP033032:1742752-1743675 [Agrobacterium tumefaciens]
MSQHLDDLVNVPDTRELELARRDLDMLNQRYTEIAKEAGWLAASSIPVVGGVVDVASAIGNAWTGNWADAGLDLVGLVPV
WGDGAKAAAKGTKIARYAEKLMSQVAAAQRKVKALEDHVRKSAAASKYWASKRGEAYRKLQEDLRKCNTKACRQKKIDEY
KNGGKYKNIPREGKWSGEPGNSKWSPEPGTPADKALKEYGQDGVQYRNGKPDFSPFSQKGPDGKPIEARIPDMQGNHAAR
NGDFGQARTAMKERYGSWNASKMEDGYTWHHNEDTSTMQLVDERIHAVKSGGGAHTGGASAVKDPAY*

  Nucleotide sequence: 924 bp    .

>EFF01855 NZ_CP033032:1742752-1743675 [Agrobacterium tumefaciens]
ATGAGCCAGCACCTCGATGACCTCGTCAATGTTCCTGACACGCGCGAGCTTGAACTGGCCCGTCGCGATCTGGATATGCT
GAACCAGCGCTACACCGAAATCGCGAAAGAAGCGGGTTGGCTGGCTGCTTCGTCCATTCCCGTGGTGGGTGGCGTCGTGG
ATGTCGCGAGCGCCATTGGAAACGCCTGGACCGGTAACTGGGCAGATGCCGGTCTGGATCTGGTCGGTCTCGTTCCCGTC
TGGGGCGATGGTGCCAAGGCTGCTGCCAAGGGCACCAAGATCGCGCGGTATGCCGAAAAACTGATGAGTCAGGTTGCTGC
TGCCCAACGCAAGGTCAAGGCGCTCGAAGACCACGTACGAAAGTCGGCGGCGGCATCGAAATACTGGGCTTCCAAACGTG
GCGAAGCCTACCGGAAGCTTCAGGAAGACCTTAGGAAATGCAATACGAAGGCATGCCGCCAGAAAAAGATCGACGAGTAT
AAGAATGGTGGCAAATACAAGAACATTCCCCGAGAGGGGAAGTGGTCTGGAGAGCCGGGCAACAGCAAGTGGTCTCCTGA
ACCGGGAACTCCTGCCGATAAGGCACTGAAAGAGTATGGGCAGGATGGTGTTCAATACCGAAATGGTAAACCCGATTTCT
CACCCTTCAGCCAGAAAGGTCCAGACGGCAAGCCCATTGAAGCACGAATACCCGATATGCAGGGCAATCACGCTGCGCGA
AATGGCGATTTCGGACAAGCGAGAACGGCGATGAAAGAAAGGTATGGTAGCTGGAACGCTTCCAAGATGGAGGACGGTTA
CACATGGCACCATAATGAGGATACATCAACAATGCAGCTTGTTGATGAACGAATCCATGCCGTAAAGTCGGGCGGAGGTG
CGCATACCGGCGGCGCTTCAGCGGTAAAAGACCCTGCATATTGA