Detailed information of effector


Summary

Effector ID EFF01836 experimental
Effector type Tme
Cognate immunity protein IMU00354 experimental
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (205 a.a.); Nucleotide sequence (615 bp)
Description SMDB11_0810, a second homologue of Ssp6.SMDB11_0810 induces detectable depolarisation in a small fraction of the cells. This effect was recovered back to the level of the empty vector control by the co-expression of the putative immunity protein, SMDB11_0809. Expression of SMDB11_0810 also led to an increase in NPN uptake.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_0810
Coordinates (Strand) 838784..839398 (-)
NCBI ID 560172663
GenBank HG326223
Uniprot ID UPI0003C9DF06
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-204 MADAVNIDSNLVRGFAQGFISVPVDFYYLGYDYIDTENRWLNSQDKERFIRLIKSGLANKASIEKVAHIFIENFASKVKFEDVKDMTIRTSGKLIGKFAFNQLATANMGYIFSKQIIPRLVSGVAVGSILTAGASISRSVYTSRDLRARNSRMYDQLRRLGNLDLLYFLLENKVRPFEDAVSVWEKDRKKFSQICQYFFAKVNV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9962 - -



  Protein sequence: 205 a.a.    .

>EFF01836 HG326223:c839398-838784 [Serratia marcescens subsp. marcescens Db11]
MADAVNIDSNLVRGFAQGFISVPVDFYYLGYDYIDTENRWLNSQDKERFIRLIKSGLANKASIEKVAHIFIENFASKVKF
EDVKDMTIRTSGKLIGKFAFNQLATANMGYIFSKQIIPRLVSGVAVGSILTAGASISRSVYTSRDLRARNSRMYDQLRRL
GNLDLLYFLLENKVRPFEDAVSVWEKDRKKFSQICQYFFAKVNV*

  Nucleotide sequence: 615 bp    .

>EFF01836 HG326223:c839398-838784 [Serratia marcescens subsp. marcescens Db11]
ATGGCGGATGCCGTAAACATTGACAGCAATTTAGTGCGCGGGTTTGCACAAGGTTTTATCAGCGTACCGGTCGATTTCTA
CTACCTGGGCTACGACTATATTGATACTGAAAACAGATGGTTAAACTCGCAAGATAAAGAGCGATTTATCAGACTCATCA
AGTCAGGCCTGGCCAATAAAGCAAGCATCGAGAAAGTGGCTCATATCTTCATCGAAAACTTCGCCAGTAAGGTCAAGTTT
GAAGATGTTAAGGACATGACCATAAGAACATCAGGCAAACTCATCGGCAAATTCGCCTTTAATCAGTTAGCCACCGCAAA
CATGGGATATATATTCTCTAAACAAATCATCCCACGGCTTGTCTCCGGTGTTGCCGTTGGCTCAATTCTCACCGCTGGGG
CAAGCATATCGCGCTCTGTCTATACATCACGCGACTTGAGGGCAAGAAACTCACGGATGTATGATCAACTCAGACGCCTG
GGAAACCTCGATCTGCTGTACTTTCTGTTAGAAAACAAAGTCCGACCATTCGAGGATGCCGTCTCGGTTTGGGAAAAAGA
TCGAAAGAAATTCAGCCAAATTTGTCAGTACTTTTTTGCAAAGGTTAACGTATGA