Detailed information of effector


Summary

Effector ID EFF01834 experimental
Effector type Tme
Cognate immunity protein IMU00353 experimental
Related T6SS (Type) T6SS01247 experimental (Type i1)
Strain Vibrio parahaemolyticus strain T9109
Replicon chromosome
Sequence Protein sequence (401 a.a.); Nucleotide sequence (1203 bp)
Description Tme2 was secreted in a T6SS1-dependent manner from T9109 and the tme/i2 cassette enabled T6SS1-dependent parental killing and Tme effectors target the periplasm of Gram-negative bacteria, causing membrane disruption and loss of membrane potential
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PO79_RS05910 (Tme2)
Coordinates (Strand) 165330..166532 (+)
NCBI ID 835943566
RefSeq NZ_JTGR01000043
Uniprot ID UPI000542CA69
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-299 MSNPESIFPKGSIAYENEQKQNPSIKSEAEAETFFPKTSIAYQNEVKANRVTPGVGKGFLPPIKKQTAFTSTQTANISPENMYWPPYDFTSGTYINTKQLPDDSLRNNLKDNQEHVMFLTLEEAFKVLQSWGWKDTQATWKSMTTSTGAQIMINYGVNGKDIVTTSMIIAQFNVHGIKATKLGLKATFGMKMSTYYNKTGTEMIKLSGYSGLRKILTGTTYRLDNPKVVQLGIGKYGLANSIKSGTVITIFVAAGFRILDYAFNDEVFLTDLVGSLATDVVKIGISSAVSAALGAASLA
Transmembrane helix 300-322 FVSFVAVNLAVVVAAGLVTSIIL
Inside 323-400 NELDEHYGITPKVIELLEKAQQEAVEKAEQLKENTYDSVLDLAGMLLEGVLETGKEVIESEVKRFIKKSLNELTPKIL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9669 - -



  Protein sequence: 401 a.a.    .

>EFF01834 NZ_JTGR01000043:165330-166532 [Vibrio parahaemolyticus]
MSNPESIFPKGSIAYENEQKQNPSIKSEAEAETFFPKTSIAYQNEVKANRVTPGVGKGFLPPIKKQTAFTSTQTANISPE
NMYWPPYDFTSGTYINTKQLPDDSLRNNLKDNQEHVMFLTLEEAFKVLQSWGWKDTQATWKSMTTSTGAQIMINYGVNGK
DIVTTSMIIAQFNVHGIKATKLGLKATFGMKMSTYYNKTGTEMIKLSGYSGLRKILTGTTYRLDNPKVVQLGIGKYGLAN
SIKSGTVITIFVAAGFRILDYAFNDEVFLTDLVGSLATDVVKIGISSAVSAALGAASLAFVSFVAVNLAVVVAAGLVTSI
ILNELDEHYGITPKVIELLEKAQQEAVEKAEQLKENTYDSVLDLAGMLLEGVLETGKEVIESEVKRFIKKSLNELTPKIL
*

  Nucleotide sequence: 1203 bp    .

>EFF01834 NZ_JTGR01000043:165330-166532 [Vibrio parahaemolyticus]
ATGAGTAACCCAGAAAGCATATTTCCTAAAGGCTCGATCGCTTATGAAAACGAGCAAAAACAAAATCCTTCCATTAAATC
CGAAGCTGAAGCCGAAACCTTTTTTCCTAAGACCTCTATTGCTTATCAAAACGAAGTTAAAGCTAATAGAGTCACACCCG
GTGTTGGTAAAGGATTTCTTCCCCCAATTAAAAAGCAAACTGCTTTTACGTCGACCCAAACCGCGAATATCAGCCCTGAA
AATATGTATTGGCCGCCATATGACTTTACTTCCGGTACATACATAAACACAAAGCAATTACCTGATGATAGTTTGCGCAA
CAACCTCAAGGATAACCAAGAACATGTGATGTTTTTGACTCTTGAAGAAGCGTTTAAGGTGCTTCAGAGCTGGGGGTGGA
AGGATACTCAAGCGACTTGGAAATCAATGACAACCTCTACTGGTGCACAGATAATGATCAATTATGGTGTGAATGGTAAA
GATATTGTAACGACTTCAATGATCATTGCTCAATTTAATGTCCATGGTATCAAGGCAACCAAACTTGGATTAAAAGCCAC
TTTTGGTATGAAAATGTCGACCTACTACAACAAAACTGGCACCGAAATGATTAAATTAAGTGGCTATTCTGGCTTAAGAA
AGATACTAACAGGTACAACCTACAGGCTTGATAATCCTAAAGTAGTTCAATTGGGTATAGGCAAGTATGGGTTAGCTAAT
TCAATCAAATCAGGAACCGTTATAACAATATTTGTCGCTGCTGGGTTTAGGATCTTAGATTACGCATTCAATGACGAAGT
TTTTTTAACCGATTTAGTAGGTTCATTGGCCACAGATGTTGTAAAAATTGGTATATCTTCGGCTGTTTCCGCAGCTTTAG
GTGCAGCTTCCCTAGCCTTCGTGTCTTTTGTTGCTGTTAATCTCGCCGTTGTCGTTGCTGCTGGTCTAGTCACTTCTATT
ATACTAAACGAGCTGGATGAGCATTACGGTATCACTCCAAAAGTTATCGAACTATTAGAAAAAGCACAGCAGGAAGCTGT
TGAAAAAGCGGAACAACTAAAAGAAAATACTTATGATAGTGTTCTCGATTTAGCTGGTATGTTACTAGAAGGCGTTTTGG
AAACAGGAAAAGAAGTGATTGAGAGCGAAGTAAAACGATTCATCAAAAAATCGTTAAATGAATTGACACCAAAAATATTA
TGA