Detailed information of effector


Summary

Effector ID EFF01832 experimental
Effector type Tme
Cognate immunity protein IMU00352 experimental
Related T6SS (Type) T6SS00719 experimental (Type i1)
Strain Vibrio parahaemolyticus BB22OP
Replicon chromosome
Sequence Protein sequence (311 a.a.); Nucleotide sequence (933 bp)
Description VPBB_RS15030 (Tme1) was responsible for the T6SS1-mediated toxicity, since its deletion from the T6SS1+ BB22OP attacker eliminated its ability to intoxicate a Δtme/i1 prey and Tme effectors target the periplasm of Gram-negative bacteria, causing membrane disruption and loss of membrane potential
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VPBB_RS15030 (Tme1)
Coordinates (Strand) 3247654..3248586 (+)
NCBI ID 505110423
RefSeq NC_019955
Uniprot ID UPI0002A55042
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-310 MRYESAPVAPKERQETTRQRAARQRRERQEELRYTASDEKRWAEIRERVLRDRQEAGLGQISQGLKTPQILSDSIGLQCSLDDEMAKNHQHVLITDLEDAHKILHNVWLDSGKDVAALAASINTAKSWFNHTEPMFDAASIAKQFGDMNIKADLVESRGKIFVAFNGTDQNGKVLKHALVNGSRINMNGKKYPLNSFKAMQTGFSPKSRVANFKGAGVLTFVVSASIATSDLVFKDDYHLVDWFGNVGSDMFKFMLQSAVGEAALFAAAVLGQPIIIGAIAVTATYLLIEWAWGEYKISQTIVERLESAI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9654 - -



  Protein sequence: 311 a.a.    .

>EFF01832 NC_019955:3247654-3248586 [Vibrio parahaemolyticus BB22OP]
MRYESAPVAPKERQETTRQRAARQRRERQEELRYTASDEKRWAEIRERVLRDRQEAGLGQISQGLKTPQILSDSIGLQCS
LDDEMAKNHQHVLITDLEDAHKILHNVWLDSGKDVAALAASINTAKSWFNHTEPMFDAASIAKQFGDMNIKADLVESRGK
IFVAFNGTDQNGKVLKHALVNGSRINMNGKKYPLNSFKAMQTGFSPKSRVANFKGAGVLTFVVSASIATSDLVFKDDYHL
VDWFGNVGSDMFKFMLQSAVGEAALFAAAVLGQPIIIGAIAVTATYLLIEWAWGEYKISQTIVERLESAI*

  Nucleotide sequence: 933 bp    .

>EFF01832 NC_019955:3247654-3248586 [Vibrio parahaemolyticus BB22OP]
ATGAGATATGAATCCGCTCCTGTAGCCCCAAAAGAAAGACAAGAAACAACTAGACAGCGAGCAGCTCGCCAACGTAGAGA
GCGTCAGGAAGAGTTGAGGTATACCGCGAGCGATGAAAAGCGATGGGCAGAAATTAGAGAGAGGGTTCTTAGAGATAGAC
AAGAGGCTGGATTAGGTCAAATCTCTCAAGGTTTAAAAACGCCTCAAATTCTAAGCGATTCTATCGGGCTACAGTGTTCA
CTTGACGATGAAATGGCGAAGAATCATCAGCATGTACTTATTACTGATTTAGAAGATGCGCACAAGATATTGCATAACGT
TTGGCTAGATTCTGGTAAAGACGTTGCAGCTCTTGCAGCGAGTATTAATACAGCAAAATCATGGTTCAACCACACAGAGC
CGATGTTTGACGCCGCGTCTATTGCTAAGCAATTCGGGGATATGAACATTAAGGCGGATCTTGTTGAGAGCAGAGGAAAA
ATCTTTGTTGCATTCAATGGGACAGATCAGAACGGGAAAGTACTCAAACATGCGTTAGTGAATGGCTCTCGTATCAACAT
GAACGGAAAAAAATACCCGCTTAATTCATTTAAAGCAATGCAAACTGGTTTTAGCCCGAAATCTAGGGTTGCAAACTTTA
AAGGTGCAGGAGTTTTAACGTTTGTTGTATCGGCGAGTATTGCTACTAGTGACCTAGTGTTCAAAGATGATTACCACCTA
GTGGATTGGTTTGGGAATGTTGGCTCTGACATGTTCAAATTTATGCTCCAAAGCGCAGTTGGTGAAGCCGCATTGTTTGC
TGCTGCTGTCTTAGGTCAACCGATAATTATCGGTGCAATTGCTGTAACAGCGACATATCTTCTAATTGAATGGGCTTGGG
GCGAATACAAAATTTCTCAAACGATAGTTGAAAGGTTAGAAAGTGCGATATAA