Detailed information of effector


Summary

Effector ID EFF01826 experimental
Effector type Tse
Cognate immunity protein IMU00349 experimental
Related T6SS (Type) T6SS01216 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (900 a.a.); Nucleotide sequence (2700 bp)
Description Kp52145 T6SS-dependent intra and inter species bacterial competition is dependent on VgrG4 and GST-VgrG4 caused a strong inhibition of yeast growth show VgrG4 is a bona fide T6SS toxin and that the C-terminal extension containing the DUF2345 domain is sufficient for the anti-bacterial and anti-eukaryotic effect. And ROS generation mediates the antibacterial effects of VgrG4.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BN49_RS18800 (VgrG4)
Coordinates (Strand) 3498991..3501690 (-)
NCBI ID 802146982
RefSeq NZ_FO834906
Uniprot ID W9BAA4_KLEPN
KEGG ID kpnk:BN49_3373
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 2.7e-67 35..355
DUF2345 PF10106.11 9.2e-49 612..759
T6SS_Vgr PF13296.8 1.7e-33 491..592
Phage_base_V PF04717.14 7.9e-07 405..472

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-899 MDTSSIITGTTLNRYQLDIPSCAASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGGGALQQLADCKRVHGVITTFRRVNRSEDQSTYQITLQPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHLHDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLPVNSPSGMSDSGAESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRHRERGDKIEPQTETANFYARLDHERFLAHQTLITASSTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGTGFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDADRDEKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNVIRTPANNKLRMEDKRGEEHIKLSTDYGGKTQLNLGHNVNAQRELRGEGFELRTDKWGAIRAGKGIFITADKQSTASGKILAMQDTLDRLKQAGDEMDSLSRDAQSAKADPAQVEQQLAFMREQIDQLREAVAVLSAPNGVALASGKHLQLTARRNLMLNAGADADMGVMKRLFIGVGEGLSLFVRKLGMKLIANQGPVAIQAQNDQLQLLARKELEIVSTDSEIHIVAKKKIIINAGGSYITLDPYRIELGTGGDVDVKAADFSYSGPASMKADHPDYPPLQSTVRQSLKLNVAQSPNASDSSWAGMPYTLYADGALLKQGVLDERGQISVDHQVVTRSYKLEMANGVSYQIPVAEAYSRPEQGELANRGFHHHTSQAASDINPPSSHTEHRNTYADLLDGHIEQDESQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9841 - -



  Protein sequence: 900 a.a.    .

>EFF01826 NZ_FO834906:c3501690-3498991 [Klebsiella pneumoniae]
MDTSSIITGTTLNRYQLDIPSCAASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGGGALQQLADCK
RVHGVITTFRRVNRSEDQSTYQITLQPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHLHDWEYEFNLKQHYPRREQIN
QYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLPVNSPSGMSDSGAESIWGLSITHNVVEANVT
TRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRHRERGDKIEPQTETANFYARLDHERFLAHQTLITASSTAAW
LAPAQVLTVTDSLPSTLPAPVQDPLLITGTGFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKAND
IYAWQDASGLYRVKFDADRDEKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDP
VTEKNSTRNVIRTPANNKLRMEDKRGEEHIKLSTDYGGKTQLNLGHNVNAQRELRGEGFELRTDKWGAIRAGKGIFITAD
KQSTASGKILAMQDTLDRLKQAGDEMDSLSRDAQSAKADPAQVEQQLAFMREQIDQLREAVAVLSAPNGVALASGKHLQL
TARRNLMLNAGADADMGVMKRLFIGVGEGLSLFVRKLGMKLIANQGPVAIQAQNDQLQLLARKELEIVSTDSEIHIVAKK
KIIINAGGSYITLDPYRIELGTGGDVDVKAADFSYSGPASMKADHPDYPPLQSTVRQSLKLNVAQSPNASDSSWAGMPYT
LYADGALLKQGVLDERGQISVDHQVVTRSYKLEMANGVSYQIPVAEAYSRPEQGELANRGFHHHTSQAASDINPPSSHTE
HRNTYADLLDGHIEQDESQ*

  Nucleotide sequence: 2700 bp    .

>EFF01826 NZ_FO834906:c3501690-3498991 [Klebsiella pneumoniae]
ATGGATACCTCTTCAATAATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTGCCGCATCGCTGGA
TGTGGAAGAATTCAGTGGGGCAGAAAAACTGAGTGAACTTTATTATTACACTATTACGTTTACCAGCGCAGAGAAAAATA
TTGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGCGGCGCACTGCAGCAGTTGGCGGACTGCAAA
CGCGTCCATGGTGTGATTACCACCTTCCGGCGCGTCAATCGTTCTGAAGATCAGTCGACCTATCAGATAACCCTCCAGCC
GTTTCTCTCCCTGCTGGATAAACAGTTTCGCAGCCACCGTTTTTTCGTCAACAAATCGGTGCCGGAGGTGGTGGAGCAGG
TATTGCAGGAACATCACCTGCATGACTGGGAGTATGAGTTTAATCTCAAGCAACACTATCCGCGGCGCGAGCAAATTAAT
CAGTATCAGGAGAGCGACCTGGCATTTATCCAGCGCCTGCTGGCAGAGGTGGGGATATTTTATTTCTTCACCCTGCAGGA
AGAGGCGCAGAGCGAAGTGGTTCACTTCGCCGACGCGCAGCGGGCGCTGATGTTCGATAAGACACTTCCTGTAAACAGCC
CGTCCGGGATGAGCGACAGCGGTGCGGAATCGATATGGGGTCTGAGCATCACCCACAACGTCGTAGAGGCGAACGTCACT
ACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAACAGCGGATATGACCCGGGGAAATGGTGAAGG
CATCACTTACGGTGAGGTATACCACTATAAGCTTCGCCACCGGGAGCGTGGCGATAAAATCGAGCCGCAGACGGAGACCG
CCAACTTTTATGCCCGCCTCGACCATGAGCGTTTTCTGGCTCACCAGACGCTTATTACCGCGAGCAGTACTGCAGCCTGG
CTGGCGCCGGCCCAGGTGCTGACCGTTACCGACAGCCTGCCGTCGACCCTGCCTGCGCCCGTACAGGATCCGCTGTTAAT
CACCGGCACCGGTTTTACCGCCAGCCGCCGGGAGGCGCTGCGGGTGTCCCTGCTGGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAAAGCGAATGAT
ATCTACGCCTGGCAGGATGCGTCCGGCCTGTACCGGGTGAAATTTGACGCTGACAGAGATGAGAAAGGGCAGGGTCAGGA
AAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGCTTTCACTTCCCGCTGATCCAGGGCACGGAGG
TGGCGATTGCTTTCCACGAAGGCGACCCTGACCGGCCGTATATTGCGCATGCGCTGCACGACTCGCGGCATGTCGATCCT
GTGACGGAGAAAAACAGCACCCGCAATGTGATTCGTACTCCGGCCAATAATAAGCTGCGAATGGAGGACAAGCGCGGCGA
GGAGCATATCAAGCTCAGCACCGATTACGGCGGCAAGACGCAGCTGAACCTGGGGCATAACGTGAATGCGCAAAGGGAGT
TGCGGGGCGAGGGGTTTGAGCTCCGGACGGATAAATGGGGGGCGATACGGGCGGGGAAAGGGATCTTTATCACCGCAGAT
AAACAGTCAACCGCCAGCGGCAAGATACTTGCAATGCAGGATACCCTGGACAGGCTTAAGCAGGCAGGTGATGAGATGGA
CTCGCTATCGCGTGATGCCCAGTCGGCTAAAGCCGACCCAGCCCAGGTTGAACAACAGTTAGCTTTTATGCGTGAGCAAA
TTGATCAGCTACGGGAGGCGGTTGCCGTGCTCAGCGCACCAAATGGTGTGGCTCTCGCCAGTGGCAAGCATCTGCAACTA
ACCGCACGTCGCAATCTGATGCTCAATGCCGGGGCAGATGCCGATATGGGCGTAATGAAACGGCTGTTTATTGGCGTGGG
GGAAGGGCTGAGCCTGTTTGTCCGCAAGCTGGGGATGAAATTAATCGCCAATCAGGGGCCCGTGGCGATTCAGGCGCAAA
ACGATCAGTTGCAGCTCCTGGCGCGCAAGGAGCTGGAGATTGTCAGTACTGATAGCGAAATTCACATTGTGGCAAAGAAA
AAAATCATCATTAACGCTGGAGGAAGCTATATCACCCTCGATCCCTATCGGATTGAGCTCGGTACTGGCGGTGATGTCGA
CGTCAAAGCCGCGGATTTTTCCTATAGCGGACCCGCCAGCATGAAGGCCGATCATCCGGATTATCCGCCACTTCAGTCCA
CCGTAAGGCAATCGCTGAAACTGAACGTGGCACAGTCGCCAAATGCGTCGGACAGCAGCTGGGCCGGAATGCCATATACC
CTGTATGCCGATGGCGCATTGTTGAAACAAGGGGTGCTGGATGAAAGAGGTCAGATATCAGTCGATCACCAGGTCGTGAC
CAGAAGTTACAAGCTGGAGATGGCTAATGGCGTCAGCTATCAGATACCCGTTGCCGAAGCGTACAGTCGCCCTGAGCAGG
GGGAACTCGCTAATCGCGGCTTTCACCACCATACCTCGCAGGCTGCATCTGATATTAACCCCCCCTCCTCACATACGGAG
CACCGTAATACTTACGCGGATTTGCTCGATGGCCATATTGAACAGGACGAAAGTCAATGA