Detailed information of effector


Summary

Effector ID EFF01811 experimental
Effector type Tde
Cognate immunity protein IMU00347 experimental
Related T6SS (Type) T6SS01063 experimental (Type i3)
Strain Bradyrhizobium japonicum strain J5
Replicon chromosome
Sequence Protein sequence (325 a.a.); Nucleotide sequence (975 bp)
Description TOX-REase-5
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) RS15455 (TseT)
Coordinates (Strand) 3215663..3216637 (-)
NCBI ID 1173687256
RefSeq NZ_CP017637
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Usp PF00582.28 1.1e-11 201..323

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-324 MTVNPTVVFDSSTDNPHLVQMLSLRLWAQLGLTTIMASAGRSAVFGCLINKGWPNYWERTAMIKDILVRLDGTPQDDIRLAAVDQIATIFESHITGLYFNLQSPLTSGEAEREDGDGVEAAALARLRRLQQETHLRRFDVAGEEDVPDTAMLPARAADTFVELCPDSRSSNPERLIERLLFGAGRHVFLVPNDLKAVSFWKHAIVAWNGSREAARALAEAMPYLHLAEKVGLLVVEGEHPTEADLLMGNDAVQHLRHHGINAVKYRAFGEEDETAGVLIEECRKLDANLLVMGSYGHSTLHELLPGSTTSRLLRRSPIPLVVAH



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8896 - -



  Protein sequence: 325 a.a.    .

>EFF01811 NZ_CP017637:c3216637-3215663 [Bradyrhizobium japonicum]
MTVNPTVVFDSSTDNPHLVQMLSLRLWAQLGLTTIMASAGRSAVFGCLINKGWPNYWERTAMIKDILVRLDGTPQDDIRL
AAVDQIATIFESHITGLYFNLQSPLTSGEAEREDGDGVEAAALARLRRLQQETHLRRFDVAGEEDVPDTAMLPARAADTF
VELCPDSRSSNPERLIERLLFGAGRHVFLVPNDLKAVSFWKHAIVAWNGSREAARALAEAMPYLHLAEKVGLLVVEGEHP
TEADLLMGNDAVQHLRHHGINAVKYRAFGEEDETAGVLIEECRKLDANLLVMGSYGHSTLHELLPGSTTSRLLRRSPIPL
VVAH*

  Nucleotide sequence: 975 bp    .

>EFF01811 NZ_CP017637:c3216637-3215663 [Bradyrhizobium japonicum]
ATGACCGTCAACCCGACCGTGGTTTTCGATAGCTCTACCGATAATCCGCACCTCGTCCAAATGCTGAGCCTGAGACTTTG
GGCCCAGCTTGGCTTGACAACCATCATGGCATCTGCCGGCCGCTCCGCGGTATTTGGCTGCTTGATCAATAAAGGCTGGC
CGAACTACTGGGAAAGGACTGCCATGATCAAGGACATACTCGTTCGTCTCGACGGAACGCCGCAGGACGACATTCGTCTG
GCGGCCGTCGACCAGATTGCCACGATATTTGAATCTCACATCACCGGTCTCTACTTCAATCTGCAGTCACCTCTCACCTC
CGGCGAAGCCGAAAGGGAGGACGGCGACGGGGTCGAAGCAGCCGCGCTGGCTCGTTTGAGACGCCTTCAGCAGGAGACGC
ACCTGCGTCGCTTTGATGTCGCGGGCGAAGAGGACGTCCCTGATACGGCCATGCTGCCAGCGCGCGCCGCCGACACGTTC
GTGGAGCTCTGTCCCGACAGCCGATCGAGCAACCCGGAGCGCTTGATCGAGCGCCTCCTTTTCGGAGCCGGCCGTCACGT
ATTCCTCGTGCCGAACGACCTCAAAGCAGTTTCTTTCTGGAAGCACGCAATCGTCGCATGGAACGGCAGTCGGGAGGCGG
CCCGCGCCTTGGCCGAGGCCATGCCTTATTTGCATCTGGCCGAGAAGGTCGGCCTGCTCGTCGTCGAAGGCGAGCACCCG
ACGGAGGCAGACCTCCTCATGGGAAACGATGCCGTACAACATCTTCGGCATCACGGCATCAATGCCGTCAAATACCGGGC
GTTTGGTGAGGAAGACGAGACCGCCGGCGTGCTGATCGAGGAATGTCGCAAGCTGGACGCCAATCTGCTGGTGATGGGCA
GTTACGGCCATTCCACCCTGCATGAATTGCTACCCGGCAGTACGACGAGCCGCCTGCTTCGTCGTTCGCCGATCCCGCTC
GTCGTTGCCCATTGA