Detailed information of effector


Summary

Effector ID EFF01808 experimental
Effector type Tde
Cognate immunity protein IMU00377 experimental
Related T6SS (Type) T6SS00127 experimental (Type i1)
Strain Myxococcus xanthus DK 1622
Replicon chromosome
Sequence Protein sequence (381 a.a.); Nucleotide sequence (1143 bp)
Description MXAN_RS36995 is associated with colony-merger incompatibility and MXAN_RS36995 is a new kind of nuclease
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) MXAN_RS36995 (PAAR-CTD)
Coordinates (Strand) 6338694..6339836 (-)
NCBI ID 1174098909
RefSeq NC_008095
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 2.3e-17 22..126

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-380 MPKVSVNAPKTPVTEGSSGVAAATLPNVCKMPGPPAPFVPTPLPNIGKSGTEPKNYSKSVTIEGKKVAIRGATFGSMGDVASKGTGGGVVSSNVEGPTSFVGPGSMDTKIEGKNVQLLGDPMLNNCGPSGSPANAATMMGLLQVSGTVTAVNGNDRCPLCRKRHGPESTLEENPTTKVNAGRLAQRVARKVRGGELPSPFSTMLGVVQCLCGKKKTYADHSGPTLKGVCDSISDLKWVGPESGLPIDATKQKVKSFIRGRFGSRKTDFDKIWERLESRARKSKRGETSSAAYPPGSCAGPKALVYCLEDNAYPRGITERWHHSEKQPVDAKIKFRDAESGEEVEGHFGHGKTVPPCLTCNFLLPAMLCPEDKVLECQHTN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7163 - -



  Protein sequence: 381 a.a.    .

>EFF01808 NC_008095:c6339836-6338694 [Myxococcus xanthus DK 1622]
MPKVSVNAPKTPVTEGSSGVAAATLPNVCKMPGPPAPFVPTPLPNIGKSGTEPKNYSKSVTIEGKKVAIRGATFGSMGDV
ASKGTGGGVVSSNVEGPTSFVGPGSMDTKIEGKNVQLLGDPMLNNCGPSGSPANAATMMGLLQVSGTVTAVNGNDRCPLC
RKRHGPESTLEENPTTKVNAGRLAQRVARKVRGGELPSPFSTMLGVVQCLCGKKKTYADHSGPTLKGVCDSISDLKWVGP
ESGLPIDATKQKVKSFIRGRFGSRKTDFDKIWERLESRARKSKRGETSSAAYPPGSCAGPKALVYCLEDNAYPRGITERW
HHSEKQPVDAKIKFRDAESGEEVEGHFGHGKTVPPCLTCNFLLPAMLCPEDKVLECQHTN*

  Nucleotide sequence: 1143 bp    .

>EFF01808 NC_008095:c6339836-6338694 [Myxococcus xanthus DK 1622]
ATGCCCAAGGTCTCAGTGAATGCGCCCAAGACCCCGGTAACTGAAGGAAGCAGTGGGGTTGCCGCAGCGACCCTGCCGAA
CGTGTGCAAGATGCCAGGGCCGCCGGCCCCGTTTGTACCAACACCGCTACCCAATATCGGCAAAAGCGGGACCGAGCCAA
AGAACTACTCGAAAAGCGTCACAATTGAAGGGAAGAAGGTTGCGATTCGGGGCGCAACGTTTGGCTCCATGGGGGATGTG
GCCAGCAAAGGAACCGGCGGCGGAGTGGTTTCCTCCAATGTGGAAGGTCCGACTAGTTTCGTCGGGCCCGGGTCCATGGA
CACGAAGATCGAGGGTAAAAACGTCCAACTGCTCGGCGACCCCATGCTCAACAACTGCGGACCGAGCGGGAGCCCAGCCA
ATGCGGCGACGATGATGGGCTTGCTTCAGGTGAGCGGCACGGTCACTGCTGTCAACGGGAATGACAGATGCCCACTTTGC
AGGAAGCGCCATGGCCCCGAAAGCACGCTCGAAGAGAATCCTACGACGAAGGTCAACGCGGGGCGGCTGGCTCAGAGGGT
TGCGAGGAAAGTGCGTGGCGGCGAACTCCCCAGTCCTTTTTCAACCATGCTGGGCGTGGTTCAGTGCCTGTGCGGCAAGA
AGAAGACCTATGCGGATCACTCAGGGCCAACGCTCAAAGGCGTCTGTGACAGCATTTCGGACCTCAAGTGGGTCGGTCCG
GAGAGTGGACTGCCGATTGACGCCACAAAACAAAAGGTCAAATCCTTCATTAGGGGACGATTTGGTAGTCGAAAGACCGA
TTTTGATAAGATATGGGAGAGACTTGAGTCCCGCGCAAGGAAGAGCAAGCGTGGCGAGACCTCGTCCGCAGCATATCCGC
CCGGCTCCTGTGCTGGGCCCAAGGCACTTGTATACTGCCTGGAGGACAATGCATATCCAAGAGGCATCACCGAGCGCTGG
CACCACAGCGAAAAGCAGCCAGTTGATGCGAAAATCAAGTTTCGCGATGCGGAGAGTGGCGAGGAAGTCGAAGGTCACTT
CGGTCATGGCAAGACCGTTCCGCCATGTCTGACATGCAACTTTCTCCTCCCCGCGATGCTCTGTCCTGAAGACAAGGTAC
TGGAATGTCAGCACACGAACTAG