Detailed information of effector


Summary

Effector ID EFF01806 experimental
Effector type Tse
Cognate immunity protein IMU38221 experimental
Related T6SS (Type) T6SS01046 experimental (Type i4b)
Strain Acinetobacter baumannii strain ATCC 17978
Replicon chromosome
Sequence Protein sequence (1002 a.a.); Nucleotide sequence (3006 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACX60_11695 (tse3)
Coordinates (Strand) 2455521..2458526 (-)
NCBI ID 446993254
RefSeq NZ_CP012004
Uniprot ID UPI0001785DCB
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1001 MNPYTIFEYTIVFYNQRNKELPNVKYSIIFFCEDGTKKTYEGATNPKGQTKPIPLNQNGKLHIFVEGHETIFSPKKTIKPILAEGSNIVEVNDIRLKSNTSFLTKAQYELMQKKTSKDLEELRKNAKAVKQKNFFNLSKIRPTFPLDLAEELNERINMSYEEYRKKNTHIVKKTKYLKFKNYALYRFVDSAGNGIPIVDYQIFAQGQSRPLINARPGPPDKKGYTQLVYTHLKSRVTYTLGSARKNSEWYEPITCVDKQTIYQIIFPTSIAVTQPDINHKENMEARQKPPIVINPTTNEVLILPSAVYAEFDKKTKILSDAVREVHKSNANLIKAIQSRDLDEIKELEKRLNINQEKAIEKINGEFKQTADLREVWVVETTGKTNEKISKYNLKRRYLKVTEYEELKAKRRNPQTEVDVTANQYTVQQPAQIRSSFEKLSQQLLTVKGNAGSDEKAVYNLIGGLGGEIAEEYKNSRDVTVTQEAQWMRMVAGASGEGSISAAPKGVSIKTSGDMSAKWTLFEGVKEWRKFYPCETGWKLEYDNYDLGTIRFLIGAEISGFSGANLGIAGNLSVDISHQGAAQVIKAVVRPPERSMSQMVDRNKKPMFQPAQGSLKIIGNNNQENAQNQGNISINAFAGVQIQGLLKGAVEWFKPKGDGSGEGEFVAIASAAAGGGVSAGVGAQGQFQIGYDQTSGNFKILVAAHLCWGMGAKGVASFVVGTEHLLSYLGFIKSQVAHAGFKTLLYINEAAFLLAAQVLAYCIGENHPVISDINRIAASYGDWIRRLDIDQGRYKTAQNINSSSGKKELLYATPETKGILLYAVTHWTDRTAPIFDMNVKFSDMKIEFFPTRKTAVINIFKTCISTEEWENTIQHIHPRGNKLTQTQLGKVEGDIIRFLNYGNDEKYAEDIIRCLNSGIEYKGTQINAWLQDYLKYRKGAKKIAGSLNYMLVKNQDDNRFKQLEIQQGVWGDSEEITLIASNLNVLSPFDQDDTDKYETYNV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9737 - -



  Protein sequence: 1002 a.a.    .

>EFF01806 NZ_CP012004:c2458526-2455521 [Acinetobacter baumannii]
MNPYTIFEYTIVFYNQRNKELPNVKYSIIFFCEDGTKKTYEGATNPKGQTKPIPLNQNGKLHIFVEGHETIFSPKKTIKP
ILAEGSNIVEVNDIRLKSNTSFLTKAQYELMQKKTSKDLEELRKNAKAVKQKNFFNLSKIRPTFPLDLAEELNERINMSY
EEYRKKNTHIVKKTKYLKFKNYALYRFVDSAGNGIPIVDYQIFAQGQSRPLINARPGPPDKKGYTQLVYTHLKSRVTYTL
GSARKNSEWYEPITCVDKQTIYQIIFPTSIAVTQPDINHKENMEARQKPPIVINPTTNEVLILPSAVYAEFDKKTKILSD
AVREVHKSNANLIKAIQSRDLDEIKELEKRLNINQEKAIEKINGEFKQTADLREVWVVETTGKTNEKISKYNLKRRYLKV
TEYEELKAKRRNPQTEVDVTANQYTVQQPAQIRSSFEKLSQQLLTVKGNAGSDEKAVYNLIGGLGGEIAEEYKNSRDVTV
TQEAQWMRMVAGASGEGSISAAPKGVSIKTSGDMSAKWTLFEGVKEWRKFYPCETGWKLEYDNYDLGTIRFLIGAEISGF
SGANLGIAGNLSVDISHQGAAQVIKAVVRPPERSMSQMVDRNKKPMFQPAQGSLKIIGNNNQENAQNQGNISINAFAGVQ
IQGLLKGAVEWFKPKGDGSGEGEFVAIASAAAGGGVSAGVGAQGQFQIGYDQTSGNFKILVAAHLCWGMGAKGVASFVVG
TEHLLSYLGFIKSQVAHAGFKTLLYINEAAFLLAAQVLAYCIGENHPVISDINRIAASYGDWIRRLDIDQGRYKTAQNIN
SSSGKKELLYATPETKGILLYAVTHWTDRTAPIFDMNVKFSDMKIEFFPTRKTAVINIFKTCISTEEWENTIQHIHPRGN
KLTQTQLGKVEGDIIRFLNYGNDEKYAEDIIRCLNSGIEYKGTQINAWLQDYLKYRKGAKKIAGSLNYMLVKNQDDNRFK
QLEIQQGVWGDSEEITLIASNLNVLSPFDQDDTDKYETYNV*

  Nucleotide sequence: 3006 bp    .

>EFF01806 NZ_CP012004:c2458526-2455521 [Acinetobacter baumannii]
ATGAATCCTTATACTATTTTTGAATATACAATAGTCTTTTATAATCAAAGAAATAAAGAATTACCAAATGTAAAATATAG
TATAATCTTTTTCTGTGAAGATGGAACAAAAAAGACTTATGAGGGTGCTACAAACCCAAAAGGACAAACAAAACCAATTC
CATTAAATCAAAATGGAAAATTGCATATTTTTGTTGAGGGGCATGAAACTATTTTCAGTCCTAAGAAGACTATAAAACCT
ATTTTGGCTGAAGGAAGCAATATAGTTGAAGTAAATGATATAAGACTTAAAAGCAATACTTCATTTCTAACAAAAGCTCA
ATATGAACTCATGCAGAAAAAAACAAGTAAAGATTTGGAAGAGTTAAGGAAAAATGCTAAAGCGGTTAAACAGAAAAATT
TTTTTAATTTATCGAAAATAAGACCAACTTTTCCTTTGGATTTGGCAGAAGAATTAAATGAAAGAATTAATATGTCTTAT
GAGGAATATAGAAAAAAGAATACTCATATCGTAAAAAAAACAAAATATCTTAAATTTAAAAACTATGCTTTATATAGATT
TGTCGATAGTGCTGGAAATGGTATTCCAATAGTGGATTATCAAATATTCGCTCAAGGCCAGAGTAGACCTTTAATAAATG
CAAGGCCGGGACCACCTGATAAAAAAGGATATACCCAATTGGTTTACACACACCTGAAAAGTAGAGTTACGTATACTTTA
GGATCTGCTAGAAAAAATAGTGAATGGTACGAGCCGATTACCTGTGTAGATAAACAAACCATTTATCAAATTATTTTTCC
GACTTCAATAGCAGTAACTCAGCCTGATATTAATCATAAAGAAAATATGGAGGCAAGACAAAAACCACCTATAGTGATTA
ACCCGACTACAAATGAAGTGCTTATTTTGCCGTCTGCAGTCTATGCAGAATTTGATAAAAAAACCAAGATATTATCTGAT
GCAGTGAGAGAAGTTCATAAGTCGAATGCAAATCTGATAAAGGCAATTCAAAGTCGTGATTTGGATGAAATCAAAGAATT
AGAAAAACGTTTAAATATAAATCAGGAAAAAGCCATTGAAAAAATTAATGGTGAATTTAAGCAAACAGCTGATCTAAGAG
AAGTGTGGGTGGTAGAGACCACAGGTAAAACAAATGAAAAAATATCTAAATATAATTTAAAACGCCGTTATTTAAAAGTT
ACGGAATATGAAGAGTTAAAAGCAAAACGTAGAAACCCTCAAACAGAAGTAGATGTAACTGCAAATCAATATACTGTACA
ACAGCCTGCACAAATTCGTAGTAGCTTTGAAAAACTTTCGCAGCAACTTTTGACAGTAAAAGGGAATGCCGGAAGTGATG
AGAAAGCTGTTTATAACCTGATAGGCGGTTTGGGTGGCGAAATTGCAGAAGAGTATAAAAATAGTAGGGATGTTACAGTT
ACTCAAGAAGCACAATGGATGCGTATGGTTGCTGGGGCAAGTGGTGAAGGTTCAATAAGTGCTGCACCAAAAGGAGTTAG
TATTAAGACTTCTGGAGATATGTCAGCTAAATGGACACTATTTGAAGGCGTTAAAGAATGGCGTAAATTTTATCCGTGCG
AAACAGGCTGGAAACTTGAATACGATAACTATGATTTAGGAACAATCCGGTTTTTAATTGGGGCGGAGATATCTGGTTTT
TCAGGAGCAAATTTAGGGATCGCTGGCAATCTATCTGTTGATATTTCTCATCAAGGAGCAGCTCAGGTTATAAAAGCTGT
AGTAAGACCGCCAGAAAGGTCAATGAGTCAAATGGTAGATCGTAACAAAAAACCTATGTTTCAGCCGGCACAAGGAAGTT
TAAAAATAATTGGTAATAATAATCAGGAAAATGCGCAGAATCAGGGTAATATCAGTATTAATGCTTTTGCTGGAGTTCAA
ATACAGGGGCTACTTAAAGGGGCTGTAGAGTGGTTTAAGCCTAAGGGGGATGGTAGTGGTGAAGGAGAATTTGTGGCGAT
TGCTTCAGCTGCAGCTGGCGGTGGTGTTAGTGCGGGCGTGGGGGCGCAAGGCCAGTTTCAAATAGGATATGATCAAACTT
CAGGTAATTTTAAAATATTGGTAGCGGCTCATTTGTGTTGGGGAATGGGAGCAAAAGGTGTGGCATCATTTGTTGTGGGT
ACGGAACATTTATTAAGTTATCTTGGTTTTATTAAATCCCAAGTTGCGCACGCAGGATTTAAAACGTTACTTTACATAAA
TGAAGCGGCTTTTTTGTTAGCTGCACAAGTTCTGGCTTATTGTATAGGTGAGAATCATCCAGTAATCAGTGATATAAATA
GAATTGCAGCTTCATATGGAGACTGGATTAGAAGGCTAGATATTGATCAAGGGCGCTATAAAACTGCACAGAATATTAAC
TCTAGTTCTGGAAAGAAGGAGTTATTATATGCTACACCAGAGACTAAAGGAATATTATTATATGCAGTAACTCATTGGAC
AGATAGAACTGCTCCTATTTTTGATATGAATGTTAAATTCTCAGATATGAAAATTGAATTTTTCCCAACTCGTAAGACAG
CAGTAATCAATATTTTTAAAACATGTATTTCTACAGAAGAGTGGGAAAATACGATTCAACATATTCATCCACGTGGTAAT
AAGCTTACTCAAACTCAATTAGGTAAAGTTGAGGGAGATATTATTCGTTTTCTTAATTATGGAAATGATGAAAAGTATGC
TGAAGATATAATCCGTTGTCTAAATTCTGGGATTGAATATAAAGGTACTCAAATCAATGCATGGCTTCAGGATTATTTAA
AATATCGTAAAGGAGCAAAAAAGATAGCAGGTTCTTTGAATTACATGTTGGTAAAAAATCAGGATGATAACCGATTTAAA
CAGCTAGAAATACAGCAGGGTGTATGGGGTGATTCAGAGGAAATAACACTAATAGCAAGTAATTTAAATGTTTTATCGCC
TTTTGATCAAGACGATACAGATAAATATGAAACATATAATGTGTAA