Detailed information of effector


Summary

Effector ID EFF01804 experimental
Effector type Tde
Cognate immunity protein IMU00346 experimental
Related T6SS (Type) T6SS01046 experimental (Type i4b)
Strain Acinetobacter baumannii strain ATCC 17978
Replicon chromosome
Sequence Protein sequence (530 a.a.); Nucleotide sequence (1590 bp)
Description tde
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACX60_15365 (tse2)
Coordinates (Strand) 3246173..3247762 (-)
NCBI ID 447036044
RefSeq NZ_CP012004
Uniprot ID A0A009K4Z3_ACIBA, A0A1E3M9A0_ACIBA
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ntox15 PF15604.8 8.2e-25 368..525

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-529 MPDPQNQQFWSKIAERPTEIQQQFWYGAEKLAKYLNDNPAMYKGYMTYDTSKPDPNLSWWEKILFYSGQAHYNEAVTHYNTSKVIADQGSWLWGMLKGDFNKDPSMSQIIVGGLISLIPVADQVCDIRDLIANFITLSDEKARTKDNYMALALTSVGIIPEVGSAIKTIVKSSRAKDVSKVKLFKFMEYFEEALTKLKIKCPWGKAPEAWLRSRPWKGIATQAFNTLKNNIDRILSVINKCLIRFNGALKVALAKFQATLNHVLNTIKKYIDQLCDEVDKAIGRLLPQQPLAMAHAGGGGKNAPTGRYEANVSSGKKTEASHRQKKETPPPPRKMKPKHVVEPCLEPKKGLRNSWGKKTGKSQAELDAEFDRQLKRQEEGLNRLTVEEYQQNRQLYEKYKRAGTGTQQQRIREDMQRQLEESEYKKLKTEQPQLSKGQIERMAENNAKKTLEGLDVLHNPDMQLGGFDVKYDPKKPPTLDDFGHSGVNRSIGSQMAAKKRLANMDAAAAQAKAKGMGKDAMDVELKRCK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9866 - -



  Protein sequence: 530 a.a.    .

>EFF01804 NZ_CP012004:c3247762-3246173 [Acinetobacter baumannii]
MPDPQNQQFWSKIAERPTEIQQQFWYGAEKLAKYLNDNPAMYKGYMTYDTSKPDPNLSWWEKILFYSGQAHYNEAVTHYN
TSKVIADQGSWLWGMLKGDFNKDPSMSQIIVGGLISLIPVADQVCDIRDLIANFITLSDEKARTKDNYMALALTSVGIIP
EVGSAIKTIVKSSRAKDVSKVKLFKFMEYFEEALTKLKIKCPWGKAPEAWLRSRPWKGIATQAFNTLKNNIDRILSVINK
CLIRFNGALKVALAKFQATLNHVLNTIKKYIDQLCDEVDKAIGRLLPQQPLAMAHAGGGGKNAPTGRYEANVSSGKKTEA
SHRQKKETPPPPRKMKPKHVVEPCLEPKKGLRNSWGKKTGKSQAELDAEFDRQLKRQEEGLNRLTVEEYQQNRQLYEKYK
RAGTGTQQQRIREDMQRQLEESEYKKLKTEQPQLSKGQIERMAENNAKKTLEGLDVLHNPDMQLGGFDVKYDPKKPPTLD
DFGHSGVNRSIGSQMAAKKRLANMDAAAAQAKAKGMGKDAMDVELKRCK*

  Nucleotide sequence: 1590 bp    .

>EFF01804 NZ_CP012004:c3247762-3246173 [Acinetobacter baumannii]
ATGCCAGATCCTCAAAATCAACAATTCTGGTCAAAGATCGCAGAACGACCTACGGAAATACAACAGCAGTTTTGGTATGG
CGCTGAAAAATTAGCAAAGTATCTCAATGATAATCCAGCTATGTATAAAGGTTATATGACCTATGATACAAGTAAGCCTG
ATCCTAATCTGTCATGGTGGGAAAAGATATTATTTTACAGTGGACAAGCTCACTACAATGAGGCGGTGACCCACTATAAC
ACCAGTAAAGTAATCGCTGATCAAGGGAGCTGGTTGTGGGGCATGCTCAAAGGTGACTTTAATAAAGATCCTTCAATGTC
TCAGATTATTGTTGGTGGACTCATAAGTCTTATACCTGTAGCTGATCAGGTGTGTGATATCCGCGATTTGATTGCCAATT
TTATCACCTTGTCGGATGAGAAAGCCCGAACGAAAGATAACTATATGGCACTTGCTTTGACAAGTGTGGGTATCATTCCT
GAAGTTGGTTCAGCAATCAAAACGATTGTGAAATCGAGTCGGGCAAAAGATGTTAGTAAGGTCAAGTTATTTAAGTTCAT
GGAGTATTTTGAGGAGGCTTTAACAAAGCTCAAAATTAAATGTCCATGGGGTAAGGCACCAGAGGCATGGTTAAGGTCTC
GACCATGGAAAGGCATAGCGACACAAGCTTTTAATACTTTAAAAAATAATATTGACCGAATCCTATCTGTCATTAATAAG
TGTTTGATACGGTTCAATGGTGCATTGAAAGTTGCCTTAGCAAAATTTCAGGCAACCCTAAACCATGTTTTAAATACCAT
CAAAAAGTATATTGATCAGTTGTGTGATGAAGTAGATAAGGCAATCGGTCGTTTATTACCTCAACAGCCATTAGCAATGG
CACATGCTGGTGGCGGTGGTAAGAATGCCCCTACAGGGCGTTATGAGGCCAATGTTAGTTCCGGTAAAAAAACAGAAGCG
AGTCATCGTCAAAAGAAAGAAACACCTCCACCACCAAGGAAAATGAAGCCGAAGCATGTGGTTGAGCCGTGTTTGGAACC
GAAAAAAGGGTTGAGGAATAGTTGGGGTAAAAAGACTGGTAAGTCTCAGGCTGAACTAGATGCCGAGTTTGACCGTCAGC
TTAAGCGGCAAGAGGAAGGGCTTAACCGTCTAACGGTTGAGGAGTATCAACAGAACAGACAACTTTATGAAAAGTATAAA
CGGGCTGGAACAGGTACTCAGCAACAAAGAATCCGAGAAGATATGCAACGACAGTTAGAGGAATCTGAATATAAAAAATT
AAAAACAGAGCAACCTCAATTATCGAAAGGCCAAATAGAAAGAATGGCTGAAAATAATGCTAAAAAAACGTTAGAAGGAT
TAGATGTCTTACATAATCCAGATATGCAATTAGGTGGTTTTGATGTCAAATATGATCCTAAAAAGCCCCCTACACTAGAT
GATTTTGGGCATAGTGGTGTAAACCGTTCTATTGGCTCTCAAATGGCCGCAAAGAAGCGGCTTGCCAATATGGATGCGGC
GGCAGCTCAAGCTAAAGCGAAGGGAATGGGGAAAGATGCGATGGATGTTGAATTGAAGCGTTGTAAGTAA