Detailed information of effector


Summary

Effector ID EFF01530 experimental
Effector type Tde
Cognate immunity protein IMU00334 experimental; IMU00351 experimental
Related T6SS (Type) T6SS01262 experimental (Type i1)
Strain Vibrio parahaemolyticus strain 12-297/B C4271
Replicon chromosome
Sequence Protein sequence (450 a.a.); Nucleotide sequence (1350 bp)
Description V12_14465 is a bona fide antibacterial DNase toxin, PoNe-containing V12_14465 functions as a DNase during bacterial competition
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12_14465 (PoNe)
Coordinates (Strand) 18950..20299 (-)
NCBI ID 659039135
RefSeq NZ_MYFG01000470
Uniprot ID A0A024B2N9_VIBPH
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-449 MLGNDIFEALYDNLEQAVGNAEGFIKEKAQQLSDAASASFEWIWEALQGDFNEDMSTGQIAANALLGLIPIVDQILDCRDLAANCRKIHEEPEDSWAWVALVLTLIGLIPTLGSAVKGVLKIIFLFVRKSGGDMGKALGRSLKPINTFLLDPKVQKVLGNISVPSVLKDVVEKLNSIKSLLSTSTLLNLFDEVINTFKGLIAKLKSLAPDEVITWMESALRSMQYVRTQADKMLPNALKEAIYKLEDLELALKKQIKSLEQPHKALADTKSIHRLDDSVAQIDPHIIRSMKNSQKGIYGEIISDHHMKERGFINLLPEDRQVRKMTDKPRGRGIDGIYQNTNPPPPYVVTETKYRTEVGKYIDDDGIAKDTMLSTTKGSKVNGMSYPPTKQMSDGWIEPRLIDELGLEGAEDILDMDFERWLMIVDDSGKVINITKLDEHAKALEKVAM



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9934 - -



  Protein sequence: 450 a.a.    .

>EFF01530 NZ_MYFG01000470:c20299-18950 [Vibrio parahaemolyticus]
MLGNDIFEALYDNLEQAVGNAEGFIKEKAQQLSDAASASFEWIWEALQGDFNEDMSTGQIAANALLGLIPIVDQILDCRD
LAANCRKIHEEPEDSWAWVALVLTLIGLIPTLGSAVKGVLKIIFLFVRKSGGDMGKALGRSLKPINTFLLDPKVQKVLGN
ISVPSVLKDVVEKLNSIKSLLSTSTLLNLFDEVINTFKGLIAKLKSLAPDEVITWMESALRSMQYVRTQADKMLPNALKE
AIYKLEDLELALKKQIKSLEQPHKALADTKSIHRLDDSVAQIDPHIIRSMKNSQKGIYGEIISDHHMKERGFINLLPEDR
QVRKMTDKPRGRGIDGIYQNTNPPPPYVVTETKYRTEVGKYIDDDGIAKDTMLSTTKGSKVNGMSYPPTKQMSDGWIEPR
LIDELGLEGAEDILDMDFERWLMIVDDSGKVINITKLDEHAKALEKVAM*

  Nucleotide sequence: 1350 bp    .

>EFF01530 NZ_MYFG01000470:c20299-18950 [Vibrio parahaemolyticus]
ATGTTAGGTAATGATATTTTTGAAGCGCTCTATGACAACTTAGAACAAGCAGTAGGCAATGCCGAAGGGTTCATTAAAGA
AAAAGCCCAACAACTTTCTGATGCAGCATCGGCAAGTTTTGAATGGATTTGGGAAGCCTTGCAAGGCGACTTCAATGAAG
ACATGTCTACTGGTCAAATTGCCGCGAATGCTTTATTAGGGCTCATCCCAATCGTTGATCAAATCCTAGACTGTCGAGAT
TTAGCCGCTAACTGTCGAAAAATACATGAAGAGCCTGAAGATAGCTGGGCTTGGGTGGCTCTGGTTCTTACCTTGATAGG
TTTAATCCCCACGTTAGGTTCCGCTGTTAAAGGGGTTCTAAAGATAATATTTCTTTTTGTTCGGAAGTCTGGCGGAGATA
TGGGAAAAGCGCTGGGTCGTTCATTAAAACCGATCAATACATTTTTGCTGGACCCAAAAGTACAAAAGGTTCTAGGAAAT
ATCAGCGTACCATCAGTCCTTAAAGATGTGGTTGAAAAACTTAATAGCATCAAAAGTCTGCTATCTACCAGTACACTACT
TAACCTGTTTGATGAAGTGATTAATACGTTTAAAGGACTAATAGCAAAACTGAAATCACTTGCACCGGATGAAGTAATAA
CGTGGATGGAAAGTGCCCTCAGAAGCATGCAATATGTGCGAACACAAGCAGATAAGATGCTTCCCAATGCGTTAAAAGAA
GCGATTTATAAATTAGAAGATCTTGAGCTTGCGTTAAAAAAACAAATCAAGAGCCTGGAGCAACCTCACAAGGCGTTAGC
CGACACTAAATCTATCCATAGACTTGATGATAGTGTTGCTCAAATTGATCCCCATATCATTCGTTCGATGAAAAACTCCC
AAAAAGGGATATATGGCGAGATTATCAGCGATCACCATATGAAAGAGCGAGGCTTTATTAACTTGTTACCTGAAGACCGG
CAAGTCAGGAAGATGACAGATAAGCCCCGTGGGCGAGGTATTGATGGTATCTACCAAAATACTAATCCGCCGCCGCCCTA
TGTTGTTACTGAAACTAAGTACCGAACTGAAGTTGGAAAATACATTGATGACGATGGTATTGCGAAAGATACCATGCTTA
GTACGACTAAAGGTAGTAAGGTCAATGGTATGAGCTACCCTCCCACAAAGCAAATGAGTGATGGGTGGATTGAACCACGT
TTAATTGATGAGCTAGGACTTGAAGGGGCAGAAGATATATTAGACATGGATTTTGAGCGTTGGTTGATGATAGTTGATGA
TTCAGGAAAAGTGATTAACATTACAAAATTAGATGAGCATGCAAAAGCTCTCGAAAAGGTGGCTATGTGA