Detailed information of effector


Summary

Effector ID EFF01525 experimental
Effector type Tge
Cognate immunity protein IMU00329 experimental
Related T6SS (Type) T6SS00946 experimental (Type Unknown)
Strain Escherichia coli strain PE117
Replicon chromosome
Sequence Protein sequence (201 a.a.); Nucleotide sequence (603 bp)
Description VT5 is a T6SS lysozyme-like, a cell-wall targeting T6SS effector of the peptidoglycan glycoside hydrolase family
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) vt4B (VT5)
Coordinates (Strand) 2536..3138 (+)
NCBI ID 1062685230
GenBank KX118293
Uniprot ID A0A1Y0R511_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
SLT PF01464.22 8.4e-06 68..168

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-200 MADKSEKKKETTNKSAKKTLTKKSEKLTPAKDTAPKQVNVDPAIRLKQIRQLVRNNNKSIMGEDYIICQIYKESRFKQFAGKNKHNAKGLMQMQRNAVRQVFKYRQQKIKGRMTTDKETNEAFANADTFYKSDKIFDEKENIKIGTEYLQYWIDKEATIEEAYRAYRGTDEAYYSVIKPCAEKLAKDPDNIQILMEGIGR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9836 - -



  Protein sequence: 201 a.a.    .

>EFF01525 KX118293:2536-3138 [Escherichia coli]
MADKSEKKKETTNKSAKKTLTKKSEKLTPAKDTAPKQVNVDPAIRLKQIRQLVRNNNKSIMGEDYIICQIYKESRFKQFA
GKNKHNAKGLMQMQRNAVRQVFKYRQQKIKGRMTTDKETNEAFANADTFYKSDKIFDEKENIKIGTEYLQYWIDKEATIE
EAYRAYRGTDEAYYSVIKPCAEKLAKDPDNIQILMEGIGR*

  Nucleotide sequence: 603 bp    .

>EFF01525 KX118293:2536-3138 [Escherichia coli]
ATGGCAGATAAATCCGAAAAGAAAAAAGAAACCACAAATAAATCAGCCAAAAAAACACTAACGAAGAAGAGCGAAAAATT
AACTCCAGCAAAAGACACCGCACCAAAACAAGTGAATGTAGATCCAGCTATAAGATTGAAACAAATTCGTCAACTTGTCC
GTAATAATAATAAATCCATCATGGGAGAGGATTATATTATTTGTCAAATCTATAAAGAATCTAGATTTAAGCAATTTGCA
GGTAAGAATAAACATAATGCGAAAGGCTTAATGCAAATGCAACGAAATGCAGTGAGGCAGGTTTTTAAATATCGACAACA
AAAAATAAAAGGAAGAATGACGACTGATAAAGAGACAAATGAAGCTTTCGCTAATGCTGATACATTTTATAAATCTGATA
AAATATTTGATGAAAAAGAAAATATTAAGATTGGCACAGAGTATTTGCAATACTGGATAGATAAAGAAGCAACAATTGAG
GAGGCATATCGGGCATATCGTGGAACAGATGAAGCATACTATTCTGTTATAAAACCTTGCGCTGAAAAACTGGCTAAAGA
TCCTGATAACATACAAATACTAATGGAGGGAATAGGAAGATAG