Detailed information of effector


Summary

Effector ID EFF01518 experimental
Effector type Tpe
Cognate immunity protein IMU00321 experimental
Related T6SS (Type) T6SS00941 experimental (Type Unknown)
Strain Escherichia coli strain STEC004
Replicon chromosome
Sequence Protein sequence (1621 a.a.); Nucleotide sequence (4863 bp)
Description Rhs-CT1,Metallopeptidase MPTase4
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ct1C (Rhs-CT1)
Coordinates (Strand) 2411..7273 (+)
NCBI ID 1062685107
GenBank KX118288
Uniprot ID A0A1C9CJG6_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-MPTase4 PF15640.8 7.7e-32 1485..1613
DUF6531 PF20148.1 1.5e-11 393..463
PAAR_motif PF05488.15 1.1e-08 266..310
RHS_repeat PF05593.16 8.7e-08 679..716
RHS_repeat PF05593.16 8.7e-07 869..904
RHS_repeat PF05593.16 1.5e-06 618..653
RHS_repeat PF05593.16 8.7e-06 721..759
RHS_repeat PF05593.16 1.2e-05 976..1009

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1620 MSEGPGGPQGATAGGTLAMRMLSQQAMVASQMKRAANDKAIAQMLASKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVTIAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSENVKINGELAARAAVTLPPPPPPGAIPEVPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASLLFPAGPVLMEFATMVGGRGEIKKEVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGSPDVFIGGEQVTYLDIQPEFPPWQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNLLGKSGKLLGAKLGALLGKTGKSLKSIANKVIRWVTDPVDPVTGAYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLRFAFDGDSDTTVNPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPNDRMYMLGGMSDTASNRITFERDSQYRITGVSHTDGIRLKLTYHASGYLKAIHRTDNGIQTLATYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDAQGRCVTVTGAEGYYNATLDYGDGCTTVTDGKGTHRYYYDPDGNILREAAPDGSTTTYEWDEFHHLLARHSPAGRVEKFEYNAALGQLSRYTAADGAEWLYRYDERGLLSNITDPAGQTWTQQCDERGLPVSLVSPQGEETRLAYTAQGLLSGIFRQDERRLGIEYDHHNRPETLTDVMGREHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGIERAGTGAEGFSYDRHGNLLAWTDGNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYRYILDNCGRVTEERDWGGVVWRYRYDADGLCTARVNGLEETILYSRDAAGRLAEIITPEGKTQYAYDKSGRLTGIFSPDGISQRTGYDERGRVNVTTQGRRTIEYHYPDEHTVIRCILPPEDERDRHPDESLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQLTSQRAGLFPAEATWGGLLPSLVREYRYDSAGNVSGVTSREDYGRETRREYRLDRNGQVTAVTASGTGLGYGEGDESYGYDSCGYLKAQSAGRHRISEETERYAGGHRLKQAGNTQYDYDAAGRMVSRTKHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRHDASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQPHPSVAPQWVTRTNHAVSDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGELDPEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMYLVSDPLGLLGGEQTYRYVPNPCGWVDPLGLAASSKISSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKLGIKVIRKADKYLPPNARAAFDYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEALGRLSREEHVLNEILKSKNLFNEAEIAHAIKYVEGLREKFMMGLTN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9160 - -



  Protein sequence: 1621 a.a.    .

>EFF01518 KX118288:2411-7273 [Escherichia coli]
MSEGPGGPQGATAGGTLAMRMLSQQAMVASQMKRAANDKAIAQMLASKKSGPPAARLGDEIQHKSFLGALAGAVLGAIVT
IAEGCLIMAACATGPYALVLVPALMYASYKASDYVEEKQNQLESWINSFCDTDGAINTGSENVKINGELAARAAVTLPPP
PPPGAIPEVPQGEPSWGDIATDLLESAAEKAVPLAKAWGNAVITLTDSNAGFMDRVSAGASLLFPAGPVLMEFATMVGGR
GEIKKEVDFPEAGEDTALCDKENKPPRIAQGSSNVFINNQPAARKGDKLECSAAIVGGSPDVFIGGEQVTYLDIQPEFPP
WQRMILGGITIASYLLPPAGLLGKLKNLARLGKLGNLLGKSGKLLGAKLGALLGKTGKSLKSIANKVIRWVTDPVDPVTG
AYCDERTDFTLGQTLPLSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLRFAFDGDSDTTVNPYHA
QYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPNDRMYMLGGMSDTASNRITFERDSQYRITG
VSHTDGIRLKLTYHASGYLKAIHRTDNGIQTLATYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYD
AQGRCVTVTGAEGYYNATLDYGDGCTTVTDGKGTHRYYYDPDGNILREAAPDGSTTTYEWDEFHHLLARHSPAGRVEKFE
YNAALGQLSRYTAADGAEWLYRYDERGLLSNITDPAGQTWTQQCDERGLPVSLVSPQGEETRLAYTAQGLLSGIFRQDER
RLGIEYDHHNRPETLTDVMGREHHTEYSGHDLPVKMRGPGGQSVRLQWQQHHKLSGIERAGTGAEGFSYDRHGNLLAWTD
GNGVVWTMEYGPFDLPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYRYILDNCGRVTEERDWGGVVWRYRYDADGLC
TARVNGLEETILYSRDAAGRLAEIITPEGKTQYAYDKSGRLTGIFSPDGISQRTGYDERGRVNVTTQGRRTIEYHYPDEH
TVIRCILPPEDERDRHPDESLLKTTYRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQLTSQR
AGLFPAEATWGGLLPSLVREYRYDSAGNVSGVTSREDYGRETRREYRLDRNGQVTAVTASGTGLGYGEGDESYGYDSCGY
LKAQSAGRHRISEETERYAGGHRLKQAGNTQYDYDAAGRMVSRTKHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRH
DASGRRTEKRCDRKKIRFTYLWDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQPHPSVAPQWVTRTNHAVSD
LTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGELDPEADPGLLYAGQWQDAESGLCYNRFRYYEPETGMY
LVSDPLGLLGGEQTYRYVPNPCGWVDPLGLAASSKISSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKLGIKV
IRKADKYLPPNARAAFDYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEALGRLSREEHVLNEILKSKNLFNEAEI
AHAIKYVEGLREKFMMGLTN*

  Nucleotide sequence: 4863 bp    .

>EFF01518 KX118288:2411-7273 [Escherichia coli]
ATGAGTGAAGGACCAGGCGGGCCACAGGGAGCGACCGCAGGCGGTACGCTGGCAATGCGAATGCTGTCACAGCAGGCGAT
GGTCGCCAGCCAGATGAAACGGGCAGCCAACGACAAAGCCATTGCACAGATGTTGGCATCAAAAAAGTCCGGCCCCCCCG
CCGCCAGGCTGGGCGATGAAATTCAGCACAAGAGTTTTTTGGGGGCGCTGGCAGGGGCCGTGCTGGGGGCGATAGTGACC
ATCGCAGAAGGTTGCCTGATTATGGCCGCCTGTGCCACCGGCCCTTATGCGCTGGTTCTGGTGCCTGCGCTGATGTATGC
CAGCTATAAGGCGAGTGATTATGTGGAGGAGAAACAGAACCAGCTTGAATCATGGATAAACAGCTTTTGTGACACGGACG
GCGCCATCAATACCGGTTCTGAAAACGTAAAAATTAACGGCGAGCTGGCCGCACGTGCAGCGGTCACCCTTCCCCCTCCT
CCCCCACCTGGAGCAATACCTGAAGTCCCACAGGGGGAACCCTCATGGGGTGATATTGCCACTGACCTGCTTGAATCGGC
AGCGGAAAAAGCAGTACCACTGGCGAAGGCCTGGGGGAACGCTGTTATCACCCTGACGGACAGCAATGCCGGTTTTATGG
ATCGCGTCAGCGCCGGCGCATCGCTTCTGTTTCCCGCCGGTCCGGTATTAATGGAGTTTGCCACCATGGTGGGCGGGCGT
GGCGAAATCAAAAAAGAGGTGGATTTCCCGGAAGCCGGTGAGGACACGGCGCTCTGCGACAAGGAGAACAAACCACCGAG
GATAGCCCAGGGCAGCAGCAACGTCTTTATCAACAATCAGCCTGCCGCACGCAAAGGGGACAAACTGGAGTGCAGTGCGG
CGATCGTGGGAGGTTCGCCGGACGTCTTTATTGGCGGTGAACAGGTGACCTATCTGGATATCCAGCCGGAGTTCCCGCCG
TGGCAGAGAATGATCCTGGGGGGAATAACGATAGCCAGCTATCTTCTGCCGCCTGCGGGACTGCTGGGAAAACTGAAGAA
TCTGGCGAGACTCGGCAAACTGGGAAACCTGCTGGGGAAAAGCGGGAAGCTGCTGGGCGCAAAGCTCGGCGCGTTGCTGG
GGAAAACAGGTAAGTCGTTAAAAAGTATTGCCAATAAAGTCATCAGATGGGTAACAGATCCTGTCGATCCGGTAACCGGC
GCATACTGCGACGAACGTACCGACTTCACCCTGGGCCAGACCCTCCCCCTCTCCTTCACCCGTTTCCACAGTTCTGTACT
GCCGCTGCATGGCCTGACGGGCGTGGGCTGGAGCGACTCCTGGAGCGAATACGCCTGGGTGCGTGAACAGGGAAACCGGG
TGGATATCATCAGCCAGGGAGCCACGCTGAGATTTGCCTTCGACGGTGACAGTGATACGACGGTTAACCCGTATCACGCC
CAGTACATTCTGCGCCGCCGCGATGATTATCTGGAGCTGTTCGACAGGGATGCACTGAGCAGCCGCTTCTTTTATGACGC
CTTTCCGGGAATGCGTCTGCGCCACCCGGTGACTGACGATACCAGCGATGACCGCCTGGCACACAGCCCCAATGACCGGA
TGTACATGCTGGGCGGGATGAGCGACACCGCCAGCAACCGCATCACGTTTGAGCGCGACAGCCAGTACCGGATCACGGGT
GTCAGTCACACCGACGGGATCCGGCTTAAACTGACGTACCACGCCAGCGGCTACCTGAAAGCCATTCACCGCACGGATAA
CGGCATACAGACGCTGGCGACCTACGAACAGGATGCGCGGGGGCGGCTGACAGAAGCGGATGCGCGGCTGGACTACCACC
TGTTTTATGAGTACGACGCTGCGGACCGGATCATCCGCTGGTCCGATAACGACCAGACGTGGAGCCGTTTCACCTACGAT
GCACAGGGCCGGTGCGTGACCGTCACCGGGGCGGAGGGCTATTACAACGCCACGCTGGACTATGGTGACGGCTGCACCAC
CGTGACGGACGGCAAGGGCACTCACCGTTATTACTATGATCCTGACGGCAATATTCTGCGGGAAGCAGCGCCGGACGGCA
GCACCACCACGTATGAATGGGATGAATTCCATCACCTGCTGGCCCGTCACTCCCCTGCCGGGCGGGTGGAGAAGTTTGAA
TACAACGCCGCACTCGGTCAGTTAAGCCGTTACACGGCGGCAGACGGCGCGGAGTGGCTGTACCGCTATGATGAGCGCGG
CCTGCTCAGCAACATCACCGACCCAGCCGGGCAGACGTGGACACAGCAGTGTGATGAACGCGGCCTGCCGGTAAGTCTGG
TGTCGCCACAGGGCGAAGAGACCCGGCTGGCATACACCGCTCAGGGGCTGCTGTCGGGGATATTCCGCCAGGATGAACGG
CGTCTGGGCATAGAGTACGACCACCACAACCGGCCGGAAACACTCACCGACGTGATGGGCCGTGAACACCACACCGAATA
CAGCGGTCACGACCTGCCGGTGAAGATGCGCGGCCCCGGCGGTCAGTCAGTGCGGTTACAGTGGCAGCAGCACCATAAAC
TGAGTGGCATTGAACGTGCTGGAACCGGCGCGGAAGGGTTCAGCTACGACCGCCACGGCAACCTGCTGGCCTGGACGGAC
GGCAACGGCGTTGTCTGGACGATGGAATACGGCCCGTTCGATTTGCCGGTGGCGCGAACGGACGGTGAAGGCCACCGCTG
GCAGTACCGCTACGATAAAGACACGCTGCAACTGACAGAAGTCATCAATCCGCAGGGCGAGTCATACCGTTATATTCTGG
ACAACTGTGGACGGGTGACGGAAGAGCGTGACTGGGGCGGCGTGGTCTGGCGTTACCGCTATGACGCCGATGGCCTCTGT
ACCGCCAGGGTCAACGGTCTGGAGGAAACCATCCTCTACAGCCGGGACGCCGCAGGCCGCCTGGCAGAAATCATCACGCC
GGAAGGCAAAACGCAGTATGCGTATGACAAATCCGGCAGGCTGACGGGTATCTTCAGCCCGGACGGCATATCACAGCGCA
CCGGCTATGACGAACGCGGGCGGGTGAATGTCACCACTCAGGGCCGACGGACCATTGAATACCACTACCCCGACGAACAC
ACCGTCATCCGCTGTATCCTGCCACCGGAAGATGAACGCGACAGACATCCCGATGAATCCCTGCTGAAAACCACCTACCG
TTACAACGCCGCCGGAGAACTGACGGAGGTTATCCTGCCGGGGGATGAGACGCTGACGTTCAGCCGTGATGAGGCGGGAC
GTGAAGTGCTCCGGCACAGTAACCGGGGTTTTGCCTGTGAACAGGGCTGGAATGCAGCCGGTCAGCTTACCAGCCAGCGC
GCCGGACTTTTCCCGGCAGAAGCCACATGGGGCGGGCTGCTCCCCTCACTGGTACGGGAGTACCGTTACGACAGCGCGGG
TAATGTGTCAGGCGTCACCAGCCGGGAAGATTACGGACGGGAAACGCGGCGGGAATACCGGCTGGACCGGAACGGCCAGG
TCACGGCGGTGACAGCCTCAGGCACCGGGCTGGGCTATGGCGAAGGCGATGAGTCCTATGGCTATGACAGTTGTGGCTAC
CTGAAGGCGCAGTCTGCGGGCAGGCACCGGATAAGTGAAGAGACTGAGCGGTATGCCGGAGGCCACCGGCTGAAACAGGC
CGGAAACACGCAGTATGACTATGACGCCGCAGGCCGGATGGTCAGCCGGACAAAACACCGTGACGGCTATCGCCCGGAAA
CAGAGCGGTTCCGGTGGGACAGCCGTGACCAGCTGACCGGGTATTGCAGCGCACAGGGTGAGCAGTGGGAATACCGCCAC
GACGCCAGCGGCAGACGAACAGAGAAACGCTGCGACCGGAAGAAAATCCGTTTTACGTACCTGTGGGATGGCGACAGTAT
TGCGGAAATCCGGGAATACCGCGATGATAAACTGTACAGCGTAAGGCACCTGGTGTTTAACGGCTTTGAGCTGATAAGCC
AGCAGTTCAGCCGGGTACGGCAGCCGCACCCGTCCGTGGCCCCGCAGTGGGTGACGCGGACGAATCACGCGGTGAGCGAC
CTGACGGGCCGCCCGCTGATGCTCTTTAACAGTGAAGGTAAAACCGTCTGGCGACCGGGGCAGACCAGCCTGTGGGGGCT
GGCACTCAGTCTGCCCGCAGACACCGGCTACCCGGACCCGCGCGGGGAACTGGACCCGGAAGCCGACCCCGGCCTGCTGT
ATGCAGGACAGTGGCAGGATGCGGAATCAGGGCTGTGCTATAACCGGTTCCGGTATTACGAGCCGGAAACCGGAATGTAC
CTGGTGAGTGATCCGCTGGGGTTGCTGGGCGGGGAGCAGACTTACCGGTATGTGCCGAATCCTTGTGGGTGGGTTGATCC
GCTGGGATTGGCTGCAAGTTCTAAAATCAGCAGTTTGATGGACTATATTGGCGATGGTCGTCGTGTTAGTGGGCATACGG
GTTTCCTGGATGGGGTTCGTTTATCACGTAGTCAAATAAACAATATTGCTAAAGAAATGGAGAAGCTAGGAATTAAAGTA
ATAAGGAAAGCAGATAAATATTTGCCACCAAATGCTAGGGCAGCTTTTGATTATGGCCTTCGCAATATTTATCTTAGGAA
AAATGCTACCTTATATGAGGTGTATCATGAAGTGATTCATGCTAAGCAATTTGCGAAAATTGGACGAGAAGCATACGAAG
CACTAGGACGTTTATCTAGGGAGGAACACGTTCTAAATGAAATATTAAAAAGTAAAAATTTATTCAATGAAGCGGAAATA
GCTCATGCCATAAAATATGTTGAGGGATTGAGAGAAAAATTCATGATGGGACTAACAAATTGA