Detailed information of effector


Summary

Effector ID EFF01500 experimental
Effector type Tse
Cognate immunity protein IMU00319 experimental
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (1474 a.a.); Nucleotide sequence (4422 bp)
Description Rhs1 represents a novel antibacterial toxin, active in the cytoplasm of target cells and neutralized by RhsI1
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_2278 (Rhs1)
Coordinates (Strand) 2403168..2407589 (+)
NCBI ID 560174121
GenBank HG326223
Uniprot ID UPI0003247414
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 4.7e-19 295..373
RHS PF03527.16 8.8e-10 1226..1259
RHS_repeat PF05593.16 4.3e-09 720..755
PAAR_motif PF05488.15 8.6e-08 180..221
RHS_repeat PF05593.16 1.9e-07 783..817
RHS_repeat PF05593.16 1e-05 923..959

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-21 MAEIWAARKDDELIHTSALAD
Transmembrane helix 22-44 IASAVAEVAVYAVATAAVSAAAA
Inside 45-50 AAAPAL
Transmembrane helix 51-73 AGVAVLGAAATAASGCVGAGLIV
Outside 74-1473 GFATSLTGVGEHISNGCDAVANWLFPPSVSGVILTGSPNVFTNAKPAARAAGRLLTPAEIKALPAPQPPQSFWDYGAELLAAGGNILSQLWQPGVAGPSQPSQPLEEDKISCDKHPLPQYLAEGSSKVFINGQPAVRSNDRSTCEAKVSTDVSKNVQIGGGTVVVRDIKSGKLPGIGLALTVLPLLLGNPAKLVKNLPCMIGGGLAAAGVNALGEAIHAAFNPVHAATGAKVLNDEEDLDLLLPARFPLIWQRNYNSRNGYQGLFGHGWRTPFEIWVDLNDRDGVIECCLHDETGRELRFPLPEVNQPSFSAGEGLMFRRGEEGQLLIADTDGSVWRLFVPLPQTPSRLRLVSLSDEYDNALLLNYDERQRLSHIVDSAGTMTLRLEYGDPRFDDRVTALRHNDEPRVRYRYDGGGDLHQVIDAGGLVTREFHYNAQHLLTRHQQAGGPSFAYRWAMFDDWRVVEHRDSAGGGCTIDYDLAAGLTTVTEYDGLRHQHRWNAQRLIVEYTDERGEVWHYQWNDEDMLIATRDPLGHGWHFRYDEAGNLVEEEDPLGHIRLTGWLPQRALPISVKEPNGATQHFYYDERHALIAEIDALGHTQRYLRDGYGQVVQAVDANGGISHFAYDEHGQLLRARDCSGKQTLYKYTAQGWLSEVTDAAGERVHYRYDAAGRLTQLQRAEGWQETLSWNAQGQLDRYQGADGRLTHYRYDAAGRLLATRNPLDGEVVRHYDARGRLTALRNENAESYLFHWTACNLLQEEIGLDGVSTRYRYDECRRVVERRFAANTSAAFSHYFSHDGAGQLVSKQTPDGETRYRYSPLGQLLHAASYRGNAWHDEPTTAQSEVSFDYDLLGRVTREQGANGTLRYDYDPMGNRTQTTLPDGRTLRALYYGSGHLLQLALDEITLSEFERDNLHRELSRTQGRLTSRVHYDRLGRKDRREIFNDNRQRPAPASSSRQWSYDYQNNLTREEHNANPFSYQRYQYDATGRLLSRDGTRPDTERYRYDPASNLLDEGQFRQRHNRVLHYQGIDYRYDVFGRTVEKRKGHYRWQYLYDADHRLCEVVRYSQHRSEAQQHVHFHYDPLGRRTQKRVWQQSQDLRQPAGKCQTTTFLWEGFRLLQETRDGMPLTYVYADQGSYEPLARIDGHAPAQVFYFHTAPNGEPESLTDSDGTLRWQSHSSAWGRIKYEENQQDLDYSQNLRLQGQYLDRETGLHYNLFRYYDPDIGRFTQHDPIGLAGGINLYQYAPNPLGWVDPWGWKPRCAATKANDHNQAAFGRQWQGRGIYKGRDSWSNIMLKEGDIVYGGAPGQSGFYFNKATLDAAGGSRAKLWESLQVLPHEKFGYRSKIQAYRVKRETIAGTGKAISQDPTRFGEGGGTQFFLSNYKTVLEPIDKPFEIGL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.4744 - -



  Protein sequence: 1474 a.a.    .

>EFF01500 HG326223:2403168-2407589 [Serratia marcescens subsp. marcescens Db11]
MAEIWAARKDDELIHTSALADIASAVAEVAVYAVATAAVSAAAAAAAPALAGVAVLGAAATAASGCVGAGLIVGFATSLT
GVGEHISNGCDAVANWLFPPSVSGVILTGSPNVFTNAKPAARAAGRLLTPAEIKALPAPQPPQSFWDYGAELLAAGGNIL
SQLWQPGVAGPSQPSQPLEEDKISCDKHPLPQYLAEGSSKVFINGQPAVRSNDRSTCEAKVSTDVSKNVQIGGGTVVVRD
IKSGKLPGIGLALTVLPLLLGNPAKLVKNLPCMIGGGLAAAGVNALGEAIHAAFNPVHAATGAKVLNDEEDLDLLLPARF
PLIWQRNYNSRNGYQGLFGHGWRTPFEIWVDLNDRDGVIECCLHDETGRELRFPLPEVNQPSFSAGEGLMFRRGEEGQLL
IADTDGSVWRLFVPLPQTPSRLRLVSLSDEYDNALLLNYDERQRLSHIVDSAGTMTLRLEYGDPRFDDRVTALRHNDEPR
VRYRYDGGGDLHQVIDAGGLVTREFHYNAQHLLTRHQQAGGPSFAYRWAMFDDWRVVEHRDSAGGGCTIDYDLAAGLTTV
TEYDGLRHQHRWNAQRLIVEYTDERGEVWHYQWNDEDMLIATRDPLGHGWHFRYDEAGNLVEEEDPLGHIRLTGWLPQRA
LPISVKEPNGATQHFYYDERHALIAEIDALGHTQRYLRDGYGQVVQAVDANGGISHFAYDEHGQLLRARDCSGKQTLYKY
TAQGWLSEVTDAAGERVHYRYDAAGRLTQLQRAEGWQETLSWNAQGQLDRYQGADGRLTHYRYDAAGRLLATRNPLDGEV
VRHYDARGRLTALRNENAESYLFHWTACNLLQEEIGLDGVSTRYRYDECRRVVERRFAANTSAAFSHYFSHDGAGQLVSK
QTPDGETRYRYSPLGQLLHAASYRGNAWHDEPTTAQSEVSFDYDLLGRVTREQGANGTLRYDYDPMGNRTQTTLPDGRTL
RALYYGSGHLLQLALDEITLSEFERDNLHRELSRTQGRLTSRVHYDRLGRKDRREIFNDNRQRPAPASSSRQWSYDYQNN
LTREEHNANPFSYQRYQYDATGRLLSRDGTRPDTERYRYDPASNLLDEGQFRQRHNRVLHYQGIDYRYDVFGRTVEKRKG
HYRWQYLYDADHRLCEVVRYSQHRSEAQQHVHFHYDPLGRRTQKRVWQQSQDLRQPAGKCQTTTFLWEGFRLLQETRDGM
PLTYVYADQGSYEPLARIDGHAPAQVFYFHTAPNGEPESLTDSDGTLRWQSHSSAWGRIKYEENQQDLDYSQNLRLQGQY
LDRETGLHYNLFRYYDPDIGRFTQHDPIGLAGGINLYQYAPNPLGWVDPWGWKPRCAATKANDHNQAAFGRQWQGRGIYK
GRDSWSNIMLKEGDIVYGGAPGQSGFYFNKATLDAAGGSRAKLWESLQVLPHEKFGYRSKIQAYRVKRETIAGTGKAISQ
DPTRFGEGGGTQFFLSNYKTVLEPIDKPFEIGL*

  Nucleotide sequence: 4422 bp    .

>EFF01500 HG326223:2403168-2407589 [Serratia marcescens subsp. marcescens Db11]
ATGGCTGAGATCTGGGCAGCAAGAAAGGATGATGAACTGATCCACACCAGCGCGTTGGCGGACATCGCCAGCGCCGTCGC
CGAAGTCGCGGTGTATGCGGTGGCGACCGCCGCCGTGTCCGCAGCAGCCGCCGCCGCAGCGCCGGCATTGGCAGGGGTGG
CGGTGCTCGGCGCAGCGGCGACGGCGGCCTCCGGCTGCGTCGGCGCCGGGCTGATCGTCGGTTTTGCCACCAGCCTGACC
GGCGTCGGAGAACATATCAGCAACGGCTGCGACGCCGTGGCCAACTGGCTCTTCCCGCCTTCCGTCTCCGGCGTCATTCT
CACGGGCTCCCCCAACGTCTTCACCAACGCCAAACCGGCGGCACGCGCCGCAGGTCGTTTACTCACGCCCGCAGAGATCA
AAGCGTTACCGGCGCCACAGCCGCCGCAAAGCTTCTGGGATTATGGCGCCGAGCTGCTGGCCGCCGGCGGTAATATCCTC
TCGCAGCTATGGCAGCCCGGCGTCGCCGGCCCCAGCCAGCCCAGCCAACCGCTGGAAGAAGATAAAATCAGCTGCGACAA
ACACCCGCTTCCGCAATACCTGGCGGAAGGCTCCAGTAAAGTATTTATCAACGGCCAACCGGCCGTACGCAGCAATGACC
GTTCAACCTGCGAGGCGAAAGTCTCGACCGACGTCTCCAAAAATGTGCAGATCGGCGGCGGCACGGTGGTGGTACGCGAC
ATCAAGAGCGGCAAGCTGCCGGGTATCGGTTTGGCGCTGACCGTGCTGCCGCTGCTGCTCGGTAATCCGGCCAAGCTGGT
TAAGAACCTGCCTTGCATGATCGGCGGCGGTCTGGCGGCGGCGGGCGTTAACGCCCTCGGCGAAGCGATCCACGCCGCCT
TTAACCCGGTGCATGCCGCCACCGGCGCCAAGGTATTGAACGACGAAGAAGATCTGGACCTGTTGCTGCCGGCGCGCTTT
CCGCTGATCTGGCAGCGCAATTACAACAGCCGCAATGGCTATCAGGGACTGTTTGGCCACGGCTGGCGCACGCCTTTTGA
AATTTGGGTCGATCTTAACGACCGGGACGGCGTCATTGAGTGTTGCCTGCATGATGAAACCGGTCGTGAGCTACGCTTCC
CGCTGCCTGAGGTGAACCAGCCGAGCTTCAGCGCCGGTGAAGGGCTGATGTTCCGCCGCGGTGAAGAGGGACAGCTGCTG
ATCGCCGACACCGACGGCAGCGTCTGGCGGCTGTTCGTGCCGCTGCCGCAGACCCCTTCCCGCCTGAGGCTGGTGTCGTT
GAGCGATGAGTACGATAATGCGCTGCTGCTGAACTACGACGAACGACAGCGCCTGAGCCACATCGTCGACAGCGCCGGCA
CCATGACATTGCGGCTGGAATACGGCGATCCGCGCTTCGACGATCGCGTCACCGCCTTGCGGCATAACGACGAACCACGC
GTGCGCTACCGTTATGACGGCGGCGGCGATCTGCATCAGGTGATCGACGCCGGCGGCTTGGTCACGCGTGAATTTCACTA
TAACGCCCAACATCTATTGACCCGCCACCAACAGGCCGGTGGGCCCAGCTTCGCGTATCGCTGGGCGATGTTCGACGACT
GGCGCGTGGTGGAACACCGCGACAGCGCCGGCGGCGGCTGTACAATCGACTACGATTTGGCCGCCGGGTTAACGACGGTC
ACCGAGTATGACGGCTTGCGGCACCAGCACCGCTGGAACGCCCAACGGCTGATCGTCGAATATACCGACGAGCGTGGTGA
GGTCTGGCATTACCAATGGAATGACGAAGACATGCTGATCGCCACGCGCGATCCGCTCGGCCACGGCTGGCATTTCCGCT
ACGATGAAGCCGGTAATCTGGTCGAGGAAGAGGATCCGCTCGGCCATATCCGCCTCACCGGTTGGCTACCGCAGCGCGCA
CTGCCGATCAGCGTCAAGGAGCCCAACGGCGCCACACAGCATTTCTACTACGACGAGCGCCATGCCTTGATTGCCGAGAT
CGATGCGCTCGGCCATACCCAGCGCTACCTGCGCGATGGCTATGGCCAGGTGGTGCAAGCCGTCGACGCCAACGGCGGCA
TCAGCCATTTCGCTTATGATGAGCACGGGCAATTATTGCGCGCCCGCGATTGCTCCGGCAAACAAACCCTCTACAAATAT
ACGGCTCAAGGCTGGCTCAGCGAGGTGACCGACGCCGCCGGCGAACGCGTCCATTACCGCTACGATGCCGCCGGCCGCCT
GACACAGCTGCAGCGCGCCGAGGGCTGGCAAGAGACGCTGAGCTGGAACGCGCAGGGCCAGCTGGATCGCTATCAGGGGG
CCGATGGGCGCCTGACGCATTATCGCTATGACGCAGCCGGCCGCCTGCTGGCCACGCGCAATCCGCTCGATGGCGAGGTG
GTGCGCCACTACGACGCCCGCGGCAGATTAACGGCGCTGCGCAATGAGAATGCCGAAAGCTACCTGTTCCATTGGACGGC
CTGCAATCTGTTGCAGGAAGAAATCGGGTTGGACGGCGTCAGCACCCGCTATCGTTACGACGAATGCCGCCGGGTCGTCG
AGCGCCGCTTCGCCGCCAATACCTCCGCCGCCTTCTCGCACTATTTCAGCCATGACGGCGCCGGCCAACTGGTGAGCAAA
CAGACGCCCGATGGAGAAACCCGCTACCGCTACAGTCCGCTCGGCCAACTGCTGCATGCCGCCAGCTACCGCGGCAACGC
TTGGCATGACGAGCCGACAACGGCTCAGAGCGAGGTCAGTTTTGACTATGACTTGCTGGGGCGGGTGACCCGTGAGCAAG
GTGCCAACGGTACGCTACGCTATGATTACGATCCGATGGGTAACCGCACGCAAACCACCTTGCCCGACGGACGCACGCTG
CGCGCACTGTACTACGGTAGCGGCCACCTGCTGCAGCTGGCGCTGGACGAGATCACCCTCAGCGAGTTCGAGCGCGACAA
TCTGCACCGCGAACTGAGCCGTACGCAGGGTCGCCTGACCAGCCGAGTGCATTATGATCGGCTGGGGCGCAAAGACCGGC
GGGAGATCTTCAATGACAACCGCCAGCGCCCGGCGCCGGCCAGCAGCTCGCGCCAGTGGTCTTACGACTATCAAAACAAC
CTGACGCGCGAAGAACACAACGCCAACCCGTTCTCCTACCAGCGTTATCAGTACGATGCCACCGGTCGATTGCTGAGCCG
GGACGGCACGCGGCCGGATACCGAGCGCTACCGGTACGATCCGGCATCCAACCTGCTGGATGAGGGGCAATTCCGCCAGC
GGCACAACCGCGTACTGCATTATCAGGGAATTGATTACCGGTACGATGTCTTTGGCCGCACGGTGGAAAAACGCAAAGGC
CACTACCGTTGGCAATATCTCTACGACGCCGATCATCGCCTCTGCGAGGTGGTGCGCTACAGCCAGCATCGCAGCGAAGC
CCAGCAGCATGTGCATTTCCACTATGATCCGCTCGGGCGGCGCACGCAAAAGCGGGTGTGGCAGCAAAGTCAGGATCTGC
GCCAACCGGCCGGCAAATGCCAAACCACCACGTTTTTGTGGGAAGGTTTCCGGCTGCTGCAGGAAACTCGCGACGGCATG
CCCCTCACCTATGTCTATGCCGATCAGGGCAGCTATGAACCTTTGGCGCGCATCGACGGCCACGCGCCGGCCCAAGTATT
TTACTTCCACACGGCGCCGAACGGCGAACCGGAAAGCCTGACCGACAGCGACGGAACGCTGCGCTGGCAGAGCCACAGCA
GCGCCTGGGGCCGCATAAAGTATGAGGAAAATCAGCAAGATCTGGATTACTCCCAAAACCTGCGCCTGCAGGGGCAATAC
CTGGATCGGGAAACGGGATTGCACTACAATTTGTTCCGCTATTACGATCCGGATATCGGCAGATTTACCCAGCACGATCC
GATAGGTTTGGCCGGCGGGATCAACCTGTACCAATACGCGCCGAATCCGCTGGGTTGGGTGGATCCTTGGGGATGGAAGC
CACGATGCGCAGCAACCAAAGCCAACGATCATAATCAGGCAGCTTTTGGTCGACAATGGCAAGGTCGAGGTATCTACAAA
GGACGAGACTCTTGGTCAAATATCATGTTGAAAGAAGGTGACATTGTTTATGGCGGCGCTCCAGGGCAATCTGGTTTTTA
CTTCAACAAGGCGACGCTAGATGCTGCAGGTGGCAGTAGAGCCAAGCTATGGGAAAGTTTGCAGGTGCTTCCACATGAAA
AATTTGGTTATAGATCTAAAATACAAGCATATAGAGTAAAAAGAGAAACGATTGCAGGAACAGGTAAAGCGATATCTCAA
GACCCAACGAGATTCGGCGAAGGCGGAGGAACTCAATTTTTCCTTTCTAACTATAAAACTGTTCTTGAGCCAATTGATAA
GCCTTTTGAAATTGGATTGTAA