Detailed information of effector


Summary

Effector ID EFF01499 experimental
Effector type Tde
Cognate immunity protein IMU00320 experimental
Related T6SS (Type) T6SS00929 experimental (Type i3)
Strain Serratia marcescens subsp. marcescens Db11
Replicon chromosome
Sequence Protein sequence (1431 a.a.); Nucleotide sequence (4293 bp)
Description The Rhs2 C-terminal domain is a DNase toxin and exhibits DNase activity
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SMDB11_1610 (Rhs2)
Coordinates (Strand) 1689650..1693942 (+)
NCBI ID 560173453
GenBank HG326223
Uniprot ID UPI000321CA9D
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 8.2e-17 88..154
DUF6531 PF20148.1 1.5e-15 242..316
RHS PF03527.16 2.2e-11 1178..1211
RHS_repeat PF05593.16 2.5e-11 640..675
RHS_repeat PF05593.16 1.5e-06 553..590
RHS_repeat PF05593.16 8.2e-06 703..735
RHS_repeat PF05593.16 2.3e-05 402..441

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-14 MTEAARVGDTIGHS
Transmembrane helix 15-37 HALAGMIAGTLVGGLIAAAGALA
Inside 38-41 AGAL
Transmembrane helix 42-64 FVAGLAASCIGVGVLLIGASLAV
Outside 65-1430 GYLTGEAATAARDGIADAGAGSLTPKGNIVTGSPNVFINGKPAALATNSQVACSDDGPSMQMAQGSDKVSINGQPASRVGDKTNCDAQVMEGSPNVFIGGGTVTTLPIKPEVPDWLYKVSDLTLLFAGLVGGVGGAAGKLGALGKLLGKLPGINKLARIACRAGTLMTATAAVGIIARPVDIVSGQKFLDGEDDLDFVLPSRLPVAWQRYWRSGNPGDSVLGRGWNLFWESSLQPYQDGLVWRAPSGDFVAFPMVPRGHKTYCEAEKCWLMHNDDGSWQLFDVGEQIFHYPPLAGEQPSRLSMITDAIGNATSLFYDDEGLLSELVDSAGQRLMCRYAQGRLREVALQTAEGERTLARYGYDEQGQLTTVSNRAGEVTRRFGWRDGLMISHQDAAGLLNEYQWQEIDGVPRVTAYRNSAGESLEFGYDFAGGRRSAVRGDGKRAEWRLDDDDNVAQYTDFDQRRYGFIYQRGELCSVLLPGGAQRQSEWDPYGRLLSETDPLGRVTRYQYSRNSGRLFAVAYPDGSSEAQHWDTLGRPTRYVDALGNTTLYRYPDDEESLPASVIDALGGEVKLEWDARGQLTRYTDCSGSVTAYTYDALGQLTAQTDAEGHQTRYRWDNGGRLHTLIHPDGGEERFNWNAHGQLAEHQDALGSLTRWQYNALGLPVSITDRINRTRRYHYSPQGWLTRLENGNGGDYRFSYDAVGRVVAEERPDDTRHYYRYGAAGLLEEHREVGLPGGAGELTQREQRFRFDEAGQLVWRSNASAEWHYRFDAMGRLRELNRLPTASGVALGIEPDSVQMRYDAAGRLLGEQGVNGELQYQWDALANLQALTLPQGDRLQWLYYGSGHASAIKFNQQVVSEFTRDRLHRETGRSQGALQQQRRYDAMGRRSWQSSAFGHDKLTRPEDGVLWRAYRYTGRGELAGVSDALRGEVHYGYDAEGRLLQHREPNQGKPGARLVYDLADNLLGERSPQSDIDAHLPLAPIADNRLTHWQKLFYRYDAWGNLISRRNGLYEQHYRYDADNRLVQAHGRGPQGEFEAQYHYDALGRRSRKTVHYKGKTEQTTHFLWQGYRLLQEQRDDGSRRSWSYDPASPWSPLAALEQAGDSRSADIYWYHTDLNSAPLEVTDAAGNLCWSGQYDTFGKLQGQTVAGAAKRQGAQYQQPLRYAGQYQDDESGLHYNLFRYYEPEVGRFTTQDPIGLEGGLNLYAYGPNPLTWIDPFGLSNCSTLDRIIGDANKVASRGGAITAKQAQILRDNLPVVQRRSVFQNQMARKEFVRDQHYLMSQWEANTGRTWPTGATPHHIIPLESGGANKWWNLMPTHGTLPNHSLPGVPGPHAAGGVLRTTVQQSRKALPPGTITDLRL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9300 - -



  Protein sequence: 1431 a.a.    .

>EFF01499 HG326223:1689650-1693942 [Serratia marcescens subsp. marcescens Db11]
MTEAARVGDTIGHSHALAGMIAGTLVGGLIAAAGALAAGALFVAGLAASCIGVGVLLIGASLAVGYLTGEAATAARDGIA
DAGAGSLTPKGNIVTGSPNVFINGKPAALATNSQVACSDDGPSMQMAQGSDKVSINGQPASRVGDKTNCDAQVMEGSPNV
FIGGGTVTTLPIKPEVPDWLYKVSDLTLLFAGLVGGVGGAAGKLGALGKLLGKLPGINKLARIACRAGTLMTATAAVGII
ARPVDIVSGQKFLDGEDDLDFVLPSRLPVAWQRYWRSGNPGDSVLGRGWNLFWESSLQPYQDGLVWRAPSGDFVAFPMVP
RGHKTYCEAEKCWLMHNDDGSWQLFDVGEQIFHYPPLAGEQPSRLSMITDAIGNATSLFYDDEGLLSELVDSAGQRLMCR
YAQGRLREVALQTAEGERTLARYGYDEQGQLTTVSNRAGEVTRRFGWRDGLMISHQDAAGLLNEYQWQEIDGVPRVTAYR
NSAGESLEFGYDFAGGRRSAVRGDGKRAEWRLDDDDNVAQYTDFDQRRYGFIYQRGELCSVLLPGGAQRQSEWDPYGRLL
SETDPLGRVTRYQYSRNSGRLFAVAYPDGSSEAQHWDTLGRPTRYVDALGNTTLYRYPDDEESLPASVIDALGGEVKLEW
DARGQLTRYTDCSGSVTAYTYDALGQLTAQTDAEGHQTRYRWDNGGRLHTLIHPDGGEERFNWNAHGQLAEHQDALGSLT
RWQYNALGLPVSITDRINRTRRYHYSPQGWLTRLENGNGGDYRFSYDAVGRVVAEERPDDTRHYYRYGAAGLLEEHREVG
LPGGAGELTQREQRFRFDEAGQLVWRSNASAEWHYRFDAMGRLRELNRLPTASGVALGIEPDSVQMRYDAAGRLLGEQGV
NGELQYQWDALANLQALTLPQGDRLQWLYYGSGHASAIKFNQQVVSEFTRDRLHRETGRSQGALQQQRRYDAMGRRSWQS
SAFGHDKLTRPEDGVLWRAYRYTGRGELAGVSDALRGEVHYGYDAEGRLLQHREPNQGKPGARLVYDLADNLLGERSPQS
DIDAHLPLAPIADNRLTHWQKLFYRYDAWGNLISRRNGLYEQHYRYDADNRLVQAHGRGPQGEFEAQYHYDALGRRSRKT
VHYKGKTEQTTHFLWQGYRLLQEQRDDGSRRSWSYDPASPWSPLAALEQAGDSRSADIYWYHTDLNSAPLEVTDAAGNLC
WSGQYDTFGKLQGQTVAGAAKRQGAQYQQPLRYAGQYQDDESGLHYNLFRYYEPEVGRFTTQDPIGLEGGLNLYAYGPNP
LTWIDPFGLSNCSTLDRIIGDANKVASRGGAITAKQAQILRDNLPVVQRRSVFQNQMARKEFVRDQHYLMSQWEANTGRT
WPTGATPHHIIPLESGGANKWWNLMPTHGTLPNHSLPGVPGPHAAGGVLRTTVQQSRKALPPGTITDLRL*

  Nucleotide sequence: 4293 bp    .

>EFF01499 HG326223:1689650-1693942 [Serratia marcescens subsp. marcescens Db11]
ATGACCGAAGCGGCCCGCGTCGGCGATACCATCGGGCATTCCCATGCCCTGGCCGGCATGATTGCCGGCACCCTTGTCGG
CGGCCTGATCGCCGCCGCAGGCGCACTGGCGGCGGGTGCGCTGTTCGTCGCCGGCCTGGCGGCTTCCTGTATCGGCGTCG
GCGTGCTGCTTATCGGCGCCAGCCTGGCGGTGGGGTATCTCACCGGGGAGGCGGCCACCGCGGCGCGCGACGGCATTGCC
GACGCCGGTGCCGGTAGCTTGACCCCCAAAGGCAATATCGTCACCGGCTCCCCCAACGTCTTCATCAACGGCAAACCCGC
CGCGCTCGCCACCAACAGCCAGGTGGCCTGCAGCGACGACGGCCCGAGCATGCAGATGGCGCAGGGCTCCGACAAGGTCA
GCATCAACGGCCAGCCCGCCTCGCGTGTGGGGGACAAAACCAACTGCGACGCGCAGGTGATGGAAGGTTCGCCCAACGTG
TTTATCGGCGGCGGCACCGTCACCACCTTGCCGATCAAGCCCGAAGTGCCGGATTGGCTGTATAAGGTCTCCGATCTGAC
GCTGCTGTTCGCCGGCCTGGTGGGCGGCGTGGGCGGCGCCGCCGGCAAGCTGGGGGCGCTCGGCAAACTGCTGGGCAAGC
TGCCCGGCATCAACAAACTGGCGCGCATCGCCTGCCGTGCCGGCACCCTGATGACCGCGACCGCCGCGGTTGGCATTATC
GCCCGGCCGGTGGATATCGTCAGCGGCCAGAAATTCCTCGACGGCGAAGACGATCTCGATTTCGTGCTGCCATCGCGCCT
GCCGGTCGCCTGGCAGCGCTATTGGCGCAGCGGCAACCCCGGCGACAGCGTACTGGGCCGCGGCTGGAACCTGTTCTGGG
AGAGCAGCCTGCAGCCGTATCAGGACGGCCTGGTGTGGCGCGCGCCTTCCGGCGACTTCGTCGCTTTCCCCATGGTGCCG
CGCGGTCACAAAACTTACTGCGAAGCCGAAAAATGCTGGCTGATGCACAACGACGACGGCAGTTGGCAGCTGTTTGACGT
CGGCGAACAGATTTTCCACTACCCGCCGCTGGCGGGCGAGCAGCCGAGCCGGCTCAGCATGATCACCGACGCCATCGGCA
ACGCCACCTCGCTGTTTTACGACGACGAGGGGCTGCTGAGCGAACTGGTGGACAGCGCCGGGCAGCGCCTGATGTGCCGC
TATGCGCAGGGCCGCCTGCGCGAAGTGGCGCTGCAAACCGCCGAAGGCGAACGAACGCTGGCGCGCTACGGTTATGATGA
GCAGGGCCAACTGACGACGGTGAGCAACCGCGCCGGTGAGGTGACGCGCCGCTTTGGCTGGCGCGACGGCCTGATGATCA
GCCACCAGGACGCCGCCGGGCTGCTGAACGAATACCAATGGCAAGAGATCGACGGCGTGCCGCGCGTGACGGCCTATCGC
AACAGCGCCGGAGAATCCCTTGAGTTCGGCTATGACTTCGCCGGCGGGCGCCGCAGCGCGGTGCGCGGCGACGGCAAGCG
CGCGGAGTGGCGGCTGGATGACGACGACAACGTGGCGCAGTACACCGATTTCGACCAGCGCCGCTACGGTTTTATCTACC
AACGCGGCGAGCTGTGCAGCGTGCTGCTGCCCGGCGGCGCGCAGCGCCAGAGCGAATGGGACCCTTACGGCCGCCTGTTG
TCGGAGACCGACCCGCTCGGCCGCGTGACGCGCTATCAATATTCGCGCAACAGCGGCCGGCTGTTCGCCGTCGCGTACCC
GGACGGCAGCAGCGAGGCGCAGCACTGGGACACGCTGGGGCGCCCGACGCGTTATGTCGATGCGCTGGGCAATACCACGC
TGTACCGCTATCCGGATGACGAAGAGAGCCTGCCGGCTAGTGTGATCGACGCGCTGGGCGGGGAAGTGAAGCTGGAGTGG
GACGCCCGCGGCCAGCTGACGCGCTACACCGACTGTTCCGGCAGCGTCACGGCTTATACCTACGATGCGCTGGGGCAACT
GACGGCGCAGACCGATGCCGAAGGCCACCAGACGCGCTACCGGTGGGATAACGGCGGGCGCCTGCACACCCTGATCCACC
CGGACGGCGGCGAAGAGCGTTTTAACTGGAATGCGCACGGCCAGCTGGCCGAACATCAGGACGCGCTGGGCAGCCTGACC
CGCTGGCAGTACAACGCCCTGGGGCTGCCGGTCAGCATCACCGATCGCATCAACCGCACCCGGCGCTATCACTACAGCCC
GCAGGGCTGGCTGACGCGGCTGGAGAACGGCAACGGCGGCGACTACCGCTTCAGCTACGATGCGGTGGGCCGTGTGGTGG
CCGAAGAGCGCCCGGACGACACCCGCCACTATTATCGTTACGGCGCGGCCGGGCTGCTGGAAGAGCACCGTGAGGTCGGC
CTGCCGGGCGGCGCGGGCGAGCTGACGCAGCGCGAACAGCGCTTCCGCTTCGACGAGGCCGGGCAGCTGGTCTGGCGCAG
TAACGCCAGTGCGGAATGGCATTACCGTTTCGACGCCATGGGGCGGCTGCGTGAGCTGAACCGCCTGCCGACGGCGAGCG
GCGTGGCGCTGGGCATCGAGCCGGACAGCGTGCAGATGCGCTATGACGCCGCCGGGCGGCTGCTCGGCGAGCAAGGCGTC
AACGGCGAGCTGCAATACCAATGGGATGCATTGGCCAACCTGCAGGCGCTGACGCTGCCGCAGGGCGATCGCCTGCAGTG
GCTGTATTACGGCTCCGGCCACGCCAGCGCCATCAAATTCAACCAGCAGGTGGTGAGCGAGTTCACCCGCGATCGCCTGC
ACCGGGAAACCGGCCGCAGTCAGGGCGCGCTGCAGCAGCAGCGGCGTTACGACGCCATGGGCCGCCGCAGCTGGCAGAGC
AGCGCCTTCGGCCACGACAAACTGACCCGGCCGGAAGACGGCGTGCTGTGGCGCGCTTATCGCTACACCGGCCGCGGCGA
GCTGGCCGGGGTGAGCGACGCGCTGCGCGGCGAAGTGCACTACGGTTACGACGCCGAGGGCCGCCTGCTGCAACACCGCG
AACCCAATCAGGGCAAACCGGGCGCGCGGCTGGTGTACGACCTGGCGGATAACCTGCTGGGCGAGCGCAGCCCGCAGAGC
GATATCGACGCGCACCTGCCGCTGGCGCCGATCGCCGACAACCGCCTGACGCACTGGCAAAAACTGTTTTACCGTTACGA
TGCCTGGGGCAACCTGATCAGCCGGCGCAACGGTCTGTACGAACAGCACTACCGCTACGACGCCGACAACCGGCTGGTGC
AGGCGCACGGCCGCGGCCCGCAGGGCGAGTTCGAGGCGCAGTACCATTACGACGCGCTGGGACGCCGCAGCCGCAAAACG
GTGCACTACAAGGGCAAAACCGAACAGACGACCCATTTCCTGTGGCAGGGTTATCGGTTGCTGCAGGAGCAGCGCGACGA
CGGCAGCCGCCGCAGCTGGAGCTACGATCCGGCCAGCCCGTGGAGCCCGTTGGCGGCGCTGGAGCAGGCAGGCGACAGCC
GCTCGGCGGATATTTACTGGTATCACACCGATCTGAACAGCGCGCCGCTGGAGGTGACCGACGCGGCGGGCAACCTGTGC
TGGTCCGGGCAATACGACACCTTCGGCAAGCTGCAGGGCCAGACGGTGGCCGGCGCGGCGAAGCGGCAGGGCGCGCAATA
CCAGCAGCCGCTGCGCTACGCCGGGCAATACCAGGATGACGAAAGTGGCCTGCACTACAACCTGTTCCGCTACTACGAAC
CCGAGGTGGGGCGTTTCACCACGCAGGATCCGATAGGGTTGGAAGGCGGGCTGAATTTATATGCTTATGGGCCAAATCCT
TTAACTTGGATAGATCCATTTGGGTTAAGTAATTGTTCGACTCTTGACCGTATTATTGGTGATGCGAACAAAGTCGCTTC
GCGTGGTGGAGCTATAACAGCAAAACAAGCTCAGATACTGAGAGATAATTTACCGGTAGTTCAGAGACGGAGTGTTTTCC
AAAATCAGATGGCTCGCAAAGAGTTCGTCAGAGATCAGCATTATCTGATGAGTCAGTGGGAAGCCAATACAGGTAGAACC
TGGCCGACAGGAGCTACCCCGCACCACATAATCCCACTAGAAAGTGGGGGGGCGAATAAATGGTGGAATTTGATGCCTAC
TCATGGCACTTTGCCTAATCATTCTTTACCTGGTGTACCTGGCCCACATGCCGCCGGTGGAGTGCTTCGAACAACTGTTC
AACAAAGCAGAAAAGCACTGCCTCCTGGAACTATAACTGATTTGAGATTGTGA