Detailed information of effector


Summary

Effector ID EFF01498 experimental
Effector type Tpe
Cognate immunity protein IMU00327 experimental
Related T6SS (Type) T6SS00931 experimental (Type i4b)
Strain Escherichia coli strain TW-XM
Replicon chromosome
Sequence Protein sequence (480 a.a.); Nucleotide sequence (1440 bp)
Description XmtU was demonstrated to contain an N-terminal PAAR-repeat motif33 and a C-terminal peptidase_C39 toxin domain and a double knockout mutant lacking both xmtU and xmtV was efficiently reduced by fivefold when exposed to TW-XM or CΔxmtU
Reference
-
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) -
Coordinates (Strand) 24197..25636 (+)
NCBI ID 611963723
GenBank KF678350
Uniprot ID E2QG14_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 5.2e-11 15..116
Peptidase_C39 PF03412.17 8.2e-06 352..474

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-479 MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAGKGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTAEVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFGENTLTQMGNGAITTLHGVADLALVTFDALLDTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLINGQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLDSNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVSESSLYALSNTGSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9243 - -



  Protein sequence: 480 a.a.    .

>EFF01498 KF678350:24197-25636 [Escherichia coli]
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAGKGVISGTSQG
TGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTAEVIHDLLLLKDLLSVGNIFD
GDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFGENTLTQMGNGAITTLHGVADLALVTFDALL
DTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLINGQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPE
ENISGKVFVEPVVLEGGAGGNWTVFDEVLDSNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKF
DVGWEGNAVSESSLYALSNTGSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP*

  Nucleotide sequence: 1440 bp    .

>EFF01498 KF678350:24197-25636 [Escherichia coli]
ATGGGTAACTATCATATCGGGGATGGTGAATGTAGATTTAGAGTCGTGTGTTCTTCACCAGATGTATGTGAAGTAGGAGG
TTACAAGGTTCCTTTTGACAGTTACCAGACTTTAGATAGTGAAAGACAGTACAGTTCAACGGTATGGGCGCGTGGATGCA
GAGCTTTAAATGTTGGTTCAGTGATTGCTGGAACTCAAAGTAATGCCGGTAAAGGTGTCATATCCGGTACATCTCAAGGA
ACGGGTGACTGTGTTATTTTAACGGGAAGTCCGACTGTAACAATAGAAGGGAAACCTGTTGCTTATCATGGTTCAGTTGT
TGGGATTAATAACCACAACTGCCTTGGTAAATTGTATACCAAAATAAAATCACCAATGATTTCTGTCATTGATAGAACTT
TTAATTATGAAAGGACTGCTGAAGTAATACACGATTTACTGCTTCTGAAGGATCTCCTCTCTGTTGGTAATATTTTTGAC
GGAGATATTTCACCTGAGGTTAAAAATGATTTATTTCAAATAAAAGATCCTGACCAATCATGGGGGGAGTTTTTTTCAAT
AAAGAATATCAGAGAATCTCTCAGGAATGGTATTGAAGGAGATAAATCTCAGATCAGAGAATGGTTTGGAGAGAACACAC
TTACTCAAATGGGGAATGGAGCAATCACCACTTTACATGGTGTGGCGGATTTAGCCTTAGTTACATTCGATGCTCTGTTA
GATACGGCAACGGCAACGGTTGCTTGCCCGATAGGCGAAGATGGGTTATGTGAACAGGCAAATATAAATTTAAATGAAAA
AGAACAGGCTTTATTTAATATTAGTAATTCATTGATAAATGGGCAAGCATGGGATGCACTTAAAAAAATGATAATGGATA
CAAATAATGGTGATCAGATTGCTCTGGAGCATTTTGCCAGCTTTTTATGGGGCTTTATGATACCCGCAAAAATACCAGAA
GAAAATATCTCTGGGAAAGTATTTGTAGAGCCAGTAGTTTTAGAAGGTGGTGCTGGTGGCAATTGGACAGTATTTGATGA
GGTTTTAGATTCAAATGTAATAAAGCAATTGACTTTAACAGGCTGTGGAGCGGCCTGTGGGGAAATGTTGCTTAGGGATA
GGTATATTTTTGTCACGCAAAATGTAATTGGAACAGAATTAACATCTATGACGTCGCTGGCAAACAAGCTTAATAAATTT
GATGTCGGCTGGGAAGGGAATGCAGTGAGCGAATCTAGTTTATATGCCCTCAGTAATACTGGTTCATGGGGAGCAATGAT
GTGGGATTCTGGAAGTAAAGTAGGGCATTGGGTACTTGTTAAGGGTGTTGATGATGCTGGGAATGTGATAATATATGATC
CATATCAAGGGAGTCGATATCTGATGACTGAACAGGAATTTAAGGAGGTATGGAATGGGCATAGTGTTTACAAACCATAA