Detailed information of effector


Summary

Effector ID EFF01497 experimental
Effector type Tme
Cognate immunity protein IMU00312 experimental
Related T6SS (Type) T6SS00926 experimental (Type iii)
Strain Bacteroides fragilis 638R
Replicon chromosome
Sequence Protein sequence (990 a.a.); Nucleotide sequence (2970 bp)
Description Bfe2 (putative transmembrane protein)
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Bf638R_1979 (Bfe2)
Coordinates (Strand) 2336050..2339019 (-)
NCBI ID 504064731
RefSeq NC_016776
Uniprot ID E1WVT6_BACF6
KEGG ID bfg:BF638R_1979
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-588 MENHIIASFSLKASGRGKEATGGKLYIVDCVRLYLLRHVPYSPETSSYSIAPLKEVREYDTVPGLPDLKSHGYSYILNPLRKGFVYVYIEKKSGQGIYREYEVSEEGSLTNLVWSDANDDRVSWDNPNRELSRPYLPLKRELDKKLWITFSPVRWSQKYAEDLLNDADKRNRRMQAIDCAKCFDGSFCQDSMSVEDANESWLYSRYMGEDTESNYDYCQAAFSSRHNDRKRRAYANVAQDGDSGDFYVTVLDPLGVADFLCRDYTSKCKELQAFIEKMRTGDFEDPYKRSELSALIDLGIVTYRMWDTPTSLFYKYRSHLNENLLKAVLKVEERKAIRKKINKIRYALNDTMRDAAYKLAVEDYLNNDTYGQLKGKEMLFKHFEGVLVEPEKIDGYMDGPINAAGIRSSGEPDVDDFIDKFVLGDENTAKLLRTEWDLDKISASTALVATAGVTLDSAVNGLFEWIPKIKNAKRQEILLINTFRFTTNNGRHTVKFPACEIPDRLIGKIDYSHLTTSTYAGKGRAYSVDFERVRDSKGNPLSTKASSWAKLDKLEVTVDTAMSRWKKSILNLGNKRWMKGLEKFVNSP
Transmembrane helix 589-606 HFLRGMAGLSIICLGIAV
Inside 607-646 RKEEKTIKDKLDITAYSAEIAFLSMKYVNQSKTIEKMMPQ
Transmembrane helix 647-669 LSVKWVGLATGLLFAGSAIWDGV
Outside 670-694 SLFDSDQDAAANLLITSGVSGALSS
Transmembrane helix 695-717 IFFFVEMATGVAIALALISFASY
Inside 718-989 ALAEWIRRNELQLLLENCAYGIEYNFKADSGAQLLELARAKSIYVKRQNLLLRQPWVLSQLTNLEQGLMSASMRLYFTFERISYHESTISFKSVLLDYITFTFHLFNMPLIEGSAEISLLHINEQGKESILNDFLLDEYQDNVTVNAEKGTVTVRFNIRRGIVDRYKKYFTGGQIKAMIRTTHITATGETIHTPTNIHGKEQCAAFYIKYKNTHSVSQTMSKVGASGARKDIPLENGVSFVSYSRKDLPLENDRLYEECASTKAEIEPKWQE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9760 - -



  Protein sequence: 990 a.a.    .

>EFF01497 NC_016776:c2339019-2336050 [Bacteroides fragilis 638R]
MENHIIASFSLKASGRGKEATGGKLYIVDCVRLYLLRHVPYSPETSSYSIAPLKEVREYDTVPGLPDLKSHGYSYILNPL
RKGFVYVYIEKKSGQGIYREYEVSEEGSLTNLVWSDANDDRVSWDNPNRELSRPYLPLKRELDKKLWITFSPVRWSQKYA
EDLLNDADKRNRRMQAIDCAKCFDGSFCQDSMSVEDANESWLYSRYMGEDTESNYDYCQAAFSSRHNDRKRRAYANVAQD
GDSGDFYVTVLDPLGVADFLCRDYTSKCKELQAFIEKMRTGDFEDPYKRSELSALIDLGIVTYRMWDTPTSLFYKYRSHL
NENLLKAVLKVEERKAIRKKINKIRYALNDTMRDAAYKLAVEDYLNNDTYGQLKGKEMLFKHFEGVLVEPEKIDGYMDGP
INAAGIRSSGEPDVDDFIDKFVLGDENTAKLLRTEWDLDKISASTALVATAGVTLDSAVNGLFEWIPKIKNAKRQEILLI
NTFRFTTNNGRHTVKFPACEIPDRLIGKIDYSHLTTSTYAGKGRAYSVDFERVRDSKGNPLSTKASSWAKLDKLEVTVDT
AMSRWKKSILNLGNKRWMKGLEKFVNSPHFLRGMAGLSIICLGIAVRKEEKTIKDKLDITAYSAEIAFLSMKYVNQSKTI
EKMMPQLSVKWVGLATGLLFAGSAIWDGVSLFDSDQDAAANLLITSGVSGALSSIFFFVEMATGVAIALALISFASYALA
EWIRRNELQLLLENCAYGIEYNFKADSGAQLLELARAKSIYVKRQNLLLRQPWVLSQLTNLEQGLMSASMRLYFTFERIS
YHESTISFKSVLLDYITFTFHLFNMPLIEGSAEISLLHINEQGKESILNDFLLDEYQDNVTVNAEKGTVTVRFNIRRGIV
DRYKKYFTGGQIKAMIRTTHITATGETIHTPTNIHGKEQCAAFYIKYKNTHSVSQTMSKVGASGARKDIPLENGVSFVSY
SRKDLPLENDRLYEECASTKAEIEPKWQE*

  Nucleotide sequence: 2970 bp    .

>EFF01497 NC_016776:c2339019-2336050 [Bacteroides fragilis 638R]
ATGGAAAATCACATCATCGCCTCGTTTTCCCTGAAAGCTTCCGGAAGAGGAAAAGAAGCTACGGGAGGTAAACTGTATAT
TGTAGACTGTGTTAGATTATATCTTCTTCGTCATGTTCCGTATAGTCCGGAAACGAGCAGTTATAGTATCGCCCCGCTCA
AGGAGGTGCGGGAGTACGACACTGTGCCCGGATTACCGGACTTGAAATCTCACGGATATTCTTACATCCTTAATCCCCTT
CGTAAGGGCTTTGTGTATGTCTACATCGAAAAGAAGAGCGGACAAGGTATTTATAGAGAGTACGAAGTGTCTGAGGAGGG
CAGTCTGACCAATCTTGTATGGTCGGATGCCAATGATGACCGAGTGTCTTGGGACAATCCCAATCGGGAATTGTCCCGCC
CTTATCTCCCCTTGAAGAGGGAGCTTGATAAGAAACTATGGATCACTTTCTCCCCCGTCCGTTGGAGTCAGAAGTATGCC
GAAGATTTACTTAATGATGCTGATAAGCGCAACCGGCGCATGCAGGCCATTGACTGTGCGAAATGTTTCGACGGGTCGTT
CTGTCAGGACAGCATGTCGGTGGAGGATGCGAATGAAAGTTGGTTGTACTCCCGGTATATGGGAGAAGATACGGAAAGCA
ACTACGATTATTGTCAAGCTGCTTTCTCCAGCCGTCACAACGACAGGAAAAGGCGTGCCTATGCCAATGTTGCGCAAGAT
GGAGATTCGGGTGACTTTTACGTCACCGTTCTCGACCCTTTGGGAGTGGCGGATTTCCTGTGCAGGGATTATACCTCCAA
ATGCAAAGAACTTCAGGCTTTCATCGAGAAGATGAGAACCGGCGATTTTGAGGATCCCTATAAACGCTCTGAGCTTTCCG
CTCTTATCGACTTGGGAATAGTGACATACCGAATGTGGGACACTCCGACGAGCCTGTTCTATAAATACAGAAGTCATTTG
AACGAAAACCTGCTCAAAGCGGTACTTAAGGTTGAAGAACGCAAGGCGATACGGAAAAAGATAAATAAGATCCGTTATGC
TTTGAACGATACCATGCGCGATGCTGCTTATAAACTAGCAGTGGAAGATTACTTGAATAATGATACTTATGGACAGCTCA
AGGGGAAAGAGATGTTGTTCAAACACTTTGAGGGAGTATTGGTCGAACCAGAGAAAATAGACGGCTACATGGATGGCCCT
ATAAATGCTGCGGGAATAAGATCATCCGGCGAGCCTGATGTGGATGACTTTATTGACAAATTTGTCTTAGGTGATGAGAA
CACTGCCAAGCTCTTGCGGACAGAGTGGGATTTAGATAAAATATCCGCATCAACTGCATTGGTTGCAACGGCGGGAGTTA
CTTTGGACAGCGCAGTGAATGGATTGTTTGAATGGATACCTAAGATAAAAAATGCCAAACGTCAGGAGATACTTCTTATT
AATACTTTCCGGTTTACGACAAACAATGGCCGACATACGGTGAAATTCCCCGCTTGTGAGATACCCGATAGATTGATAGG
CAAAATTGATTATTCACACTTAACTACCAGTACATATGCAGGTAAGGGACGAGCCTATTCTGTTGATTTTGAAAGGGTGA
GAGATTCCAAAGGGAATCCTTTATCTACTAAAGCCTCTTCGTGGGCAAAGCTTGACAAACTGGAGGTTACGGTAGATACA
GCTATGTCACGTTGGAAAAAAAGTATATTGAACTTGGGGAATAAAAGATGGATGAAAGGTCTGGAAAAGTTTGTGAATAG
TCCTCATTTCCTAAGAGGAATGGCTGGGTTGAGTATCATCTGTTTGGGGATTGCTGTTCGGAAAGAAGAAAAAACTATTA
AGGACAAACTGGATATTACTGCTTATTCCGCAGAGATTGCATTTTTGAGTATGAAATATGTTAATCAGTCAAAGACGATA
GAGAAAATGATGCCTCAATTATCTGTAAAATGGGTAGGTCTCGCCACCGGTTTATTATTTGCCGGATCTGCTATTTGGGA
TGGAGTCTCACTTTTTGACTCTGACCAAGATGCTGCTGCCAACTTATTAATTACTTCTGGTGTCTCTGGTGCCTTATCAT
CAATATTTTTTTTCGTAGAAATGGCTACTGGTGTTGCCATCGCTTTGGCTCTTATTTCTTTTGCCTCCTATGCTTTAGCA
GAATGGATAAGGCGTAATGAACTTCAATTACTTTTGGAGAACTGCGCTTATGGAATAGAGTATAATTTTAAAGCTGATTC
TGGCGCACAATTACTTGAGCTAGCTCGTGCTAAAAGTATATATGTAAAACGGCAAAACTTGCTTTTACGGCAGCCCTGGG
TTCTGAGCCAATTGACAAATTTGGAGCAGGGGCTAATGAGTGCGAGCATGCGATTATATTTCACATTTGAACGCATTTCG
TATCACGAAAGTACAATATCTTTCAAGTCTGTTCTTCTGGATTACATTACTTTCACTTTTCACCTGTTCAATATGCCGTT
AATTGAGGGAAGTGCCGAAATTAGTTTACTACATATCAATGAACAGGGAAAGGAGTCTATACTTAATGACTTCCTATTAG
ATGAGTATCAAGATAATGTAACAGTGAATGCAGAAAAAGGCACAGTTACTGTTAGATTCAATATTCGGAGAGGAATTGTT
GATAGATACAAGAAGTATTTTACCGGTGGGCAGATCAAAGCGATGATAAGAACCACTCATATTACCGCAACTGGTGAAAC
CATTCACACTCCTACAAATATTCATGGTAAAGAACAATGTGCAGCATTTTACATTAAATATAAGAATACTCATTCAGTAT
CTCAGACTATGTCGAAGGTAGGTGCGAGTGGTGCTCGTAAAGATATTCCCTTAGAGAACGGAGTATCATTTGTGAGTTAT
TCTCGTAAAGATCTTCCCTTAGAGAACGATAGATTATATGAAGAGTGTGCTTCTACAAAAGCAGAAATAGAACCTAAATG
GCAAGAATAA