Detailed information of effector


Summary

Effector ID EFF01496 experimental
Effector type Tpe
Cognate immunity protein IMU00315 experimental
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (1020 a.a.); Nucleotide sequence (3060 bp)
Description VgrG2b is a novel antibacterial protease active in the periplasm, and VgrG2bC-ter metallopeptidase represents a hitherto-undescribed family of antibacterial T6SS effectors that appear to dysregulate the cell division process
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0262 (VgrG2b)
Coordinates (Strand) 293802..296861 (-)
NCBI ID 15595459
RefSeq NC_002516
Uniprot ID VGR2B_PSEAE
KEGG ID pae:PA0262
PDB ID 6H56

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 5.6e-75 27..327
DUF2345 PF10106.11 4.8e-48 615..758
T6SS_Vgr PF13296.8 2.2e-34 475..581
Phage_base_V PF04717.14 9.1e-14 386..453

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-1019 MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKNAIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQGSSGFRRTRYELLLEPQLARLELCCNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLAFEEGLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTARQTQRDYSFKRPTYDQEHHLAGEALEHQGSSYERYDYPGRYKRSGAGRPFTESRLRGHRRDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPLGVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDREGRHDEFSTCWIRVAQNWAGADWGHMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNRPPYALPDHKILSTIKSKEYKGSRANELRIDDTTAQISAALMSDHGASALHLGYLTHPRPEGGKPRGEGFELRTDEHGAVRAAKGLLLSTEEQLRAGAGHLDRGVVVQVLEAALELARELGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATPASLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQKNDIRLEAKQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKHSHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGATQLLQKDAMNIAKVDMKHTKSPASAVAGIAAAVGAAVAVGKLLGGPDAEAGRALSEGEISLAKGVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQGLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDYNIEQQGDIVRDYFLEKNEFGEASANSRFAGVLKNFPTGY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9855 - -



  Protein sequence: 1020 a.a.    .

>EFF01496 NC_002516:c296861-293802 [Pseudomonas aeruginosa PAO1]
MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKNAIDFKQVLDQPGTFTLWQDGRPARYVHGIVSHFTQ
GSSGFRRTRYELLLEPQLARLELCCNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHLPREYCVQAGDSDHYLHDRLA
FEEGLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVLHSFRYSENVRTARQTQRDYSFKRPTYDQEH
HLAGEALEHQGSSYERYDYPGRYKRSGAGRPFTESRLRGHRRDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVR
VVHRGTQYAGQEEESADAPLGVSYDLRAELVPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDRE
GRHDEFSTCWIRVAQNWAGADWGHMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNRPPYALPDHKILSTIKSKEYKGS
RANELRIDDTTAQISAALMSDHGASALHLGYLTHPRPEGGKPRGEGFELRTDEHGAVRAAKGLLLSTEEQLRAGAGHLDR
GVVVQVLEAALELARELGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGIAAATPASLTL
AAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQKNDIRLEAKQSVEVSASQQHVLVTAKE
HITLMCGGAYLTLKGGNIELGMPGNFVVKAAKHSHVGAASLEAELPQFEVGETQRRFVLKQLDGQTAMPNVPYTITMANG
EVIEGVTDAEGATQLLQKDAMNIAKVDMKHTKSPASAVAGIAAAVGAAVAVGKLLGGPDAEAGRALSEGEISLAKGVFGD
SIDYSTVRLRDEDYVPWQGKDYVMAPNGHIYFGEELRGVADWSLESLQRQGLFIHEMTHVWQHQHGVNVLLVGAYQQARQ
FLLGDQYAYRLEPGKTLKDYNIEQQGDIVRDYFLEKNEFGEASANSRFAGVLKNFPTGY*

  Nucleotide sequence: 3060 bp    .

>EFF01496 NC_002516:c296861-293802 [Pseudomonas aeruginosa PAO1]
ATGCGTCAAAGGGACCTGAAATTCACCTTCGTCGTCGGCGAAGGGAAACTCGCGTTCGATGTCGTCGAGTTCGAACTGGA
AGAAGCGCTCTGCGAGCCTTTCCGCCTGAACCTGAAGCTGGCCAGCGACAAGAACGCCATCGATTTCAAGCAGGTACTCG
ACCAGCCGGGCACCTTCACCCTCTGGCAGGACGGCCGTCCGGCCCGCTACGTCCATGGCATCGTCAGCCACTTCACCCAG
GGCAGCTCGGGTTTTCGCCGGACCCGCTACGAACTGCTGCTGGAACCGCAGTTGGCGCGCCTGGAGCTGTGCTGCAACTG
GCGGATCTTCCAGGAGAAGAGTGTTCCGGAGATTCTCCAGGCGCTGCTCAAGGAACACCGGGTGCTCGACTACGAACAGC
GCATCTACCATGAGCACCTGCCGCGCGAATACTGCGTGCAGGCCGGCGACAGCGATCACTACCTGCACGACCGGCTGGCT
TTCGAGGAAGGCCTGGTCTACTACTTCCGCTTCGACGAACACCGCCACACCCTGGTCTGCAGCGACCGGCTCTACGTCCA
GGAGCGTATCGCCGGCGGCCCGGTACTGTTCAGCGCCCAGCCGGAGGGCGACAACCCGCAGCCGGTGCTTCATTCTTTCC
GCTACAGCGAAAATGTTCGTACGGCTCGACAGACCCAGCGGGACTACAGCTTCAAGCGCCCGACCTACGACCAGGAGCAT
CATCTCGCTGGCGAGGCGCTCGAGCATCAGGGCTCGTCCTACGAGCGCTACGACTACCCCGGTCGCTACAAGCGGAGCGG
CGCCGGCCGGCCTTTCACCGAAAGCCGCCTCAGAGGGCACCGGCGCGATGCGCGGGTGGCATCGGTCAGCGGCGACGACC
CGCGGCTGATCCCGGGCCACGCCTTTGCCCTGGAAGGTCATCCGCGTGCCGACTTCAACGCCTGGTGGCGGCCGGTGCGG
GTGGTCCATCGCGGCACCCAGTATGCCGGCCAGGAGGAAGAGTCCGCCGACGCCCCTCTGGGGGTGAGCTACGACCTGCG
CGCCGAACTGGTACCCGAGGACGTCGAATGGCGTCCCGCACCGCTGCCTCGGCCGCGTATCGATGGTCCGCAGATCGCGA
CGGTAGTCGGCCCGGCAGGGGAAGAGATCCATTGCGACGAGTGGGGACGGGTGAAGGTCCAGTTCCCCTGGGATCGCGAG
GGACGTCACGATGAGTTCAGTACCTGCTGGATACGGGTCGCGCAGAACTGGGCAGGTGCCGACTGGGGGCACATGGCGAT
CCCGCGGATTGGCCAGGAGGTGATCGTCGATTACCTGGACGGCGACTGCGACCAGCCGATCGTCACCGGGCGCACCTACC
GGGCGACCAACCGACCGCCCTACGCGCTGCCCGACCACAAGATCCTCAGCACCATCAAGAGCAAGGAGTACAAGGGCAGT
CGGGCCAACGAGCTGCGCATCGACGACACCACGGCGCAGATCAGTGCGGCGCTGATGAGCGACCACGGTGCCAGCGCGCT
GCACCTGGGCTACCTGACCCATCCTCGGCCCGAAGGCGGCAAGCCGCGCGGCGAGGGCTTCGAACTGCGCACCGACGAAC
ATGGCGCGGTGCGTGCGGCCAAGGGGCTGCTGCTGAGCACCGAGGAGCAGCTCAGGGCCGGCGCCGGCCATCTCGACCGA
GGCGTCGTGGTGCAGGTGCTGGAGGCCGCGCTGGAGCTGGCCCGCGAGCTGGGCGACTACGCCGGGGAGCACCAGGGCGT
GGGGCACGACGCGGCGCCGCAGCAAACCCTCCAGGAAGCCGTGCGCGACCTCGGCCACGGCGCCAACGACGAGTCCGGCA
AGAGCAACGGGGGCAAGCCGGCGATCGCCTTGAGCGGTCCGGCAGGGATCGCCGCGGCGACGCCGGCGAGCCTGACCCTG
GCCGCCGGCGAGCACGTCGACAGCGTGGCCCGGCAGAACCAGCAGGTGACCGCCGGGCAGAAGGTGGTGATCAACGCCGG
CAGCGACATCGGCCTGTTCGCCCAGGGCGGCGAGCTGCGCCAGATCACCCACCAGGGGCCGATGCTGCTGCAGGCGCAGA
AGAACGACATCCGCCTGGAGGCCAAGCAGAGCGTGGAGGTCAGCGCCAGCCAGCAGCACGTGCTGGTCACCGCGAAGGAG
CACATCACCCTGATGTGCGGCGGCGCCTACCTGACCCTCAAGGGCGGCAACATCGAGCTGGGCATGCCCGGCAACTTCGT
GGTCAAGGCGGCGAAGCACAGTCATGTCGGCGCGGCCAGCCTGGAAGCCGAGCTGCCGCAGTTCGAGGTGGGCGAGACGC
AGCGGCGGTTCGTCCTCAAGCAACTGGACGGGCAAACGGCCATGCCCAACGTGCCCTATACCATCACCATGGCCAACGGC
GAGGTCATCGAGGGCGTCACCGACGCCGAAGGCGCTACCCAGCTGCTGCAGAAGGATGCGATGAACATCGCCAAGGTCGA
TATGAAACACACGAAATCGCCCGCCTCCGCAGTTGCCGGGATAGCAGCGGCGGTTGGCGCGGCGGTTGCAGTCGGCAAGC
TCCTGGGTGGCCCCGACGCCGAGGCCGGACGTGCTCTCAGCGAAGGGGAAATCAGCCTGGCGAAAGGCGTATTCGGCGAT
TCCATCGACTATTCCACGGTCCGCCTGCGCGACGAGGACTATGTCCCCTGGCAGGGCAAGGACTACGTGATGGCGCCGAA
CGGCCACATCTACTTCGGCGAGGAGTTGCGCGGCGTGGCGGACTGGAGCCTGGAGAGCCTGCAGCGCCAGGGTCTGTTCA
TTCACGAAATGACCCATGTCTGGCAGCACCAGCATGGCGTCAACGTCCTTCTGGTGGGGGCCTACCAGCAAGCCAGGCAG
TTTCTCCTAGGCGACCAGTACGCCTACCGGTTGGAGCCGGGAAAGACGTTGAAGGACTACAACATCGAACAGCAGGGAGA
CATCGTTCGAGATTATTTCCTCGAGAAGAACGAGTTCGGGGAAGCCTCTGCGAACAGCAGGTTCGCTGGCGTACTGAAAA
ACTTCCCAACGGGATACTGA