Detailed information of effector


Summary

Effector ID EFF01483 experimental
Effector type Tde
Cognate immunity protein IMU00308 experimental
Related T6SS (Type) T6SS00127 experimental (Type i1)
Strain Myxococcus xanthus DK 1622
Replicon chromosome
Sequence Protein sequence (291 a.a.); Nucleotide sequence (873 bp)
Description MXAN_0050 gene encodes a protein containing an AHH domain (pfam14412), which has been predicted to be the active module of the HNH/ENDO VII nuclease superfamily
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) MXAN_RS00265
Coordinates (Strand) 57099..57971 (-)
NCBI ID 499869465
RefSeq NC_008095
Uniprot ID Q1DG90_MYXXD
KEGG ID mxa:MXAN_0050
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AHH PF14412.8 5.8e-10 123..235

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-290 MSNLSASEMNTVLAQRLLSIFERSRDRKYTAAKAAKKKKPKPAASAADDADHVDDSAPPRGVLGKDSDYAQNGSDYIASLDGRGVYRVFDHSYLDEIRDLVKQTAEFPGGPPENFNPRAKDKDKKPALQKYPYAWEAHHILPGSAFYYELEDGPVFTYRQLRLILQSDYNLNHGHNIIMLPDQAWAVPVHALLQHPGDHPNYTQQVMRDMKTIAQKLQKAIDSQKEHKALIEDVFDQLHKLENKYWKLLVALSRAVVASVTAGKEYKHALVRYAPKDKKAKSRYEWGSLY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9289 - -



  Protein sequence: 291 a.a.    .

>EFF01483 NC_008095:c57971-57099 [Myxococcus xanthus DK 1622]
MSNLSASEMNTVLAQRLLSIFERSRDRKYTAAKAAKKKKPKPAASAADDADHVDDSAPPRGVLGKDSDYAQNGSDYIASL
DGRGVYRVFDHSYLDEIRDLVKQTAEFPGGPPENFNPRAKDKDKKPALQKYPYAWEAHHILPGSAFYYELEDGPVFTYRQ
LRLILQSDYNLNHGHNIIMLPDQAWAVPVHALLQHPGDHPNYTQQVMRDMKTIAQKLQKAIDSQKEHKALIEDVFDQLHK
LENKYWKLLVALSRAVVASVTAGKEYKHALVRYAPKDKKAKSRYEWGSLY*

  Nucleotide sequence: 873 bp    .

>EFF01483 NC_008095:c57971-57099 [Myxococcus xanthus DK 1622]
ATGAGCAACCTGAGTGCGAGCGAGATGAACACGGTGCTGGCGCAGCGGCTCCTGTCCATCTTCGAGCGAAGCAGGGACCG
GAAGTACACGGCGGCCAAGGCGGCAAAGAAGAAGAAGCCGAAGCCCGCAGCCAGCGCCGCGGACGACGCCGACCACGTGG
ACGACAGCGCCCCGCCCCGGGGCGTGCTCGGCAAAGACAGCGACTACGCGCAGAACGGCTCTGACTACATCGCGTCCCTG
GACGGGCGTGGCGTGTACCGCGTCTTCGACCACTCCTACCTGGATGAAATCCGGGACCTGGTGAAGCAGACCGCTGAGTT
CCCCGGGGGGCCACCGGAGAATTTCAACCCGAGGGCCAAGGACAAGGACAAGAAGCCCGCGCTCCAGAAGTACCCGTACG
CGTGGGAGGCACACCACATCCTCCCGGGCTCGGCGTTCTACTACGAATTGGAGGACGGCCCGGTCTTCACATACCGGCAG
CTCCGCCTCATCCTCCAGTCCGACTACAATCTGAACCACGGCCACAACATCATCATGCTGCCGGACCAGGCTTGGGCCGT
GCCTGTCCACGCGCTGCTGCAGCACCCGGGCGACCATCCCAACTACACGCAGCAGGTGATGCGGGACATGAAAACCATCG
CCCAAAAGCTTCAAAAGGCGATCGACTCTCAAAAAGAACACAAGGCGTTGATCGAGGATGTTTTTGACCAGCTGCACAAG
CTGGAGAACAAGTACTGGAAACTCCTCGTTGCACTGAGCCGAGCAGTTGTGGCCTCGGTCACCGCAGGAAAAGAGTACAA
GCACGCCCTTGTGCGCTATGCCCCGAAGGACAAGAAGGCCAAGAGTCGTTATGAGTGGGGCTCTCTCTATTAA