Detailed information of effector


Summary

Effector ID EFF01482 experimental
Effector type Tde
Cognate immunity protein IMU00309 experimental
Related T6SS (Type) T6SS00005 experimental (Type i4a)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (262 a.a.); Nucleotide sequence (786 bp)
Description PA3907 encodes a TOX-REase-5 effector
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA3907 (TseT)
Coordinates (Strand) 4375230..4376015 (+)
NCBI ID 15599102
RefSeq NC_002516
Uniprot ID Q9HXA6_PSEAE
KEGG ID pae:PA3907
PDB ID 7DYM

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-REase-5 PF15648.8 5.4e-23 116..203

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-261 MSGIGALFRPLPRMGPRLPFELPAPPRPHLPMPAPRPLPRPAPGALPRPVPRPMPVPQTLPRTETGTLSRDRTREAERDCSKSQGRDKDCVECPPSRGEMAIANNGKGHSMSDLSARYQQWVTNFPFPHEWFWSGTWWDGFDEPRCTLLEAKANYAFLFVPLLGVPRPWARAKVKSDLLQKAEVHSDKARPTPPVFVEWHFLQRIVYEYCAAEYLRMGLANLKAFWNPMPGTDEHDDYQETRAKEQEEMKRFCEENPGYCA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.6370 - -



  Protein sequence: 262 a.a.    .

>EFF01482 NC_002516:4375230-4376015 [Pseudomonas aeruginosa PAO1]
MSGIGALFRPLPRMGPRLPFELPAPPRPHLPMPAPRPLPRPAPGALPRPVPRPMPVPQTLPRTETGTLSRDRTREAERDC
SKSQGRDKDCVECPPSRGEMAIANNGKGHSMSDLSARYQQWVTNFPFPHEWFWSGTWWDGFDEPRCTLLEAKANYAFLFV
PLLGVPRPWARAKVKSDLLQKAEVHSDKARPTPPVFVEWHFLQRIVYEYCAAEYLRMGLANLKAFWNPMPGTDEHDDYQE
TRAKEQEEMKRFCEENPGYCA*

  Nucleotide sequence: 786 bp    .

>EFF01482 NC_002516:4375230-4376015 [Pseudomonas aeruginosa PAO1]
ATGAGCGGCATAGGCGCGCTTTTCCGACCGCTGCCCCGCATGGGTCCGCGGCTGCCCTTCGAACTACCCGCGCCGCCCCG
GCCGCACTTGCCGATGCCGGCGCCGCGCCCGCTGCCGCGACCGGCCCCCGGCGCACTGCCCAGGCCGGTACCGCGTCCGA
TGCCGGTGCCGCAGACCCTGCCCAGGACCGAGACCGGCACGCTGAGCCGCGACCGGACCCGGGAAGCCGAGCGCGATTGC
AGCAAGAGCCAGGGCCGCGACAAGGACTGCGTGGAGTGCCCGCCGTCCCGGGGCGAAATGGCCATCGCCAATAACGGCAA
GGGCCACAGCATGTCGGACCTGTCCGCGCGCTACCAGCAGTGGGTGACCAATTTCCCGTTTCCCCACGAATGGTTCTGGA
GCGGCACCTGGTGGGACGGCTTCGACGAGCCGCGCTGCACCCTGCTGGAGGCGAAGGCCAACTACGCCTTCCTGTTCGTC
CCGCTGCTCGGCGTGCCCAGGCCCTGGGCACGGGCCAAGGTGAAGTCGGACCTGCTGCAGAAGGCCGAGGTCCACAGCGA
CAAGGCCCGACCGACCCCGCCGGTGTTCGTCGAATGGCACTTCCTGCAGCGGATCGTCTACGAGTACTGCGCCGCGGAGT
ACCTGCGCATGGGACTGGCCAACCTGAAGGCATTCTGGAATCCGATGCCGGGAACGGACGAGCACGACGACTACCAGGAA
ACCCGCGCGAAGGAACAGGAAGAGATGAAAAGGTTTTGCGAAGAGAACCCGGGGTATTGCGCATGA