Detailed information of effector


Summary

Effector ID EFF01476 experimental
Effector type Tae
Cognate immunity protein IMU00302 experimental
Related T6SS (Type) T6SS00127 experimental (Type i1)
Strain Myxococcus xanthus DK 1622
Replicon chromosome
Sequence Protein sequence (670 a.a.); Nucleotide sequence (2010 bp)
Description MXAN_5572 (TsxE) contains amidohydrolase 2 (AH2) and LysM (LM) domains
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) MXAN_5572 (TsxE)
Coordinates (Strand) 6920542..6922551 (-)
NCBI ID 108462560
RefSeq NC_008095
Uniprot ID Q1D0W2_MYXXD
KEGG ID mxa:MXAN_5572
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Amidohydro_2 PF04909.16 8.3e-05 453..565

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-669 METYVVKDGDSPDSIAQKYGFKEWKLIYEHPDNGGLRATRGANEVKADDRVIIPDLPENQVSAGGPQNLIATPGTPLTLPPVHFDAHMHIMSGNCTPMPALVQMMKDKGLGFLIGTGTSRTKINRLGFWAAKIPFAPDIGDVSHRDTHRIGEEAVRSNDSLAQDRTGYTSDGMGNVEEYTIPAPLRAYASTQGHAEASASYMGMSIVLTMDMDYCHLAGYQGDPIYSSDFDGAEPRFTYRWRTKSDDPGELIEAKSDEIRLHETWDRQLRHTEQVVAENPFRLLPMFHFEPRRFIKNEDKSFPFEKVVTASKAAPYIGFKMYTPQGYMPKERHAPVKDILSWFFSECASNDIPLMTHCTPSGFYTHERRFYLDHEPDEAIRNDPKYWPSKDAIATADANITKARDYVTELEASWKSHIPLVLRRARNGVEDAIEAKEKLLNPGRMRYFYENYVHPEAWRPVLNDNPKLRLCLAHFASDGTFWDIRKGLTVKQDGQKVQYDKSWIGSIVELCNEFPNFYTDISYLDLMEKQKWKLLADILKSSPWMLKKIMFGTDWYMITAEPVAYAAWYSRTIRGLEFIQKELPTQVNLFTQFAIVNPMRYYRMMEVAPKMKEGLKKLQTDLNVTGAAVDKLEDNFTTLMRLQHPLEQIDKAGGLASGPMLFTATTKAK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9826 - -



  Protein sequence: 670 a.a.    .

>EFF01476 NC_008095:c6922551-6920542 [Myxococcus xanthus DK 1622]
METYVVKDGDSPDSIAQKYGFKEWKLIYEHPDNGGLRATRGANEVKADDRVIIPDLPENQVSAGGPQNLIATPGTPLTLP
PVHFDAHMHIMSGNCTPMPALVQMMKDKGLGFLIGTGTSRTKINRLGFWAAKIPFAPDIGDVSHRDTHRIGEEAVRSNDS
LAQDRTGYTSDGMGNVEEYTIPAPLRAYASTQGHAEASASYMGMSIVLTMDMDYCHLAGYQGDPIYSSDFDGAEPRFTYR
WRTKSDDPGELIEAKSDEIRLHETWDRQLRHTEQVVAENPFRLLPMFHFEPRRFIKNEDKSFPFEKVVTASKAAPYIGFK
MYTPQGYMPKERHAPVKDILSWFFSECASNDIPLMTHCTPSGFYTHERRFYLDHEPDEAIRNDPKYWPSKDAIATADANI
TKARDYVTELEASWKSHIPLVLRRARNGVEDAIEAKEKLLNPGRMRYFYENYVHPEAWRPVLNDNPKLRLCLAHFASDGT
FWDIRKGLTVKQDGQKVQYDKSWIGSIVELCNEFPNFYTDISYLDLMEKQKWKLLADILKSSPWMLKKIMFGTDWYMITA
EPVAYAAWYSRTIRGLEFIQKELPTQVNLFTQFAIVNPMRYYRMMEVAPKMKEGLKKLQTDLNVTGAAVDKLEDNFTTLM
RLQHPLEQIDKAGGLASGPMLFTATTKAK*

  Nucleotide sequence: 2010 bp    .

>EFF01476 NC_008095:c6922551-6920542 [Myxococcus xanthus DK 1622]
ATGGAAACGTACGTCGTCAAGGACGGGGACTCCCCCGACTCAATCGCGCAGAAGTACGGGTTCAAGGAATGGAAGCTCAT
CTACGAGCATCCGGACAACGGGGGCCTGCGCGCCACTCGCGGCGCCAATGAAGTGAAGGCGGATGACCGGGTCATCATCC
CGGACCTGCCAGAGAACCAGGTGTCCGCCGGAGGTCCGCAGAACCTCATCGCCACGCCGGGAACGCCGCTCACCTTGCCG
CCCGTCCACTTCGACGCACACATGCACATCATGAGCGGTAACTGCACGCCCATGCCCGCGCTGGTGCAGATGATGAAGGA
CAAGGGCCTGGGCTTTCTCATCGGCACGGGCACCAGCCGCACCAAAATCAACCGCCTGGGCTTCTGGGCGGCGAAAATCC
CGTTCGCGCCCGACATCGGTGATGTGTCCCACCGCGACACGCACCGCATTGGTGAAGAGGCCGTGCGCTCCAATGACAGC
CTTGCCCAGGACCGGACGGGATACACCTCGGATGGAATGGGCAACGTGGAGGAGTACACCATCCCCGCGCCCCTGCGAGC
CTATGCGTCCACGCAGGGCCACGCGGAGGCCAGCGCTTCCTACATGGGCATGTCCATCGTCCTCACCATGGACATGGATT
ACTGCCACCTGGCTGGCTACCAGGGGGACCCTATCTACAGCTCGGATTTTGATGGGGCCGAGCCCCGCTTCACCTATCGC
TGGCGCACGAAGTCCGACGACCCTGGCGAGCTGATTGAAGCGAAGTCCGATGAGATACGGCTTCACGAGACGTGGGACCG
GCAGCTCCGGCACACCGAGCAGGTGGTCGCGGAGAATCCCTTCCGGTTGCTGCCCATGTTTCATTTCGAACCGCGCCGCT
TCATCAAGAACGAGGACAAGTCGTTCCCCTTCGAAAAGGTGGTGACGGCCTCCAAGGCGGCTCCCTACATCGGCTTCAAG
ATGTACACGCCCCAGGGCTACATGCCCAAGGAGCGCCATGCGCCGGTGAAGGACATCCTGAGCTGGTTCTTCTCCGAGTG
CGCGTCGAACGACATCCCGCTGATGACCCACTGCACGCCGTCCGGCTTCTACACACACGAGCGGCGCTTCTACCTGGACC
ACGAGCCGGACGAGGCCATCCGAAACGACCCGAAGTACTGGCCCTCGAAGGACGCCATCGCCACCGCGGACGCGAACATC
ACCAAGGCGCGCGACTACGTGACGGAGCTGGAGGCGAGCTGGAAGAGCCACATCCCGCTCGTGCTCCGCCGCGCGCGCAA
TGGCGTGGAGGACGCCATCGAGGCCAAGGAGAAGCTGCTGAACCCGGGCCGGATGCGTTACTTCTATGAGAACTACGTGC
ACCCGGAAGCGTGGCGCCCGGTGCTCAATGACAATCCGAAGCTGCGCTTGTGCCTGGCGCACTTCGCCAGCGACGGCACC
TTCTGGGACATCCGCAAGGGGTTGACCGTCAAGCAGGATGGCCAGAAGGTCCAGTACGACAAGAGCTGGATTGGCTCCAT
CGTCGAGCTGTGCAACGAGTTCCCCAACTTCTACACGGACATCTCCTATCTGGACCTGATGGAGAAGCAGAAGTGGAAGC
TGCTGGCTGACATCCTCAAGTCCAGTCCGTGGATGCTGAAGAAGATCATGTTCGGCACCGACTGGTACATGATTACCGCC
GAGCCCGTGGCGTACGCGGCTTGGTACAGCCGCACCATCCGCGGGCTGGAGTTCATCCAGAAGGAGCTGCCGACGCAGGT
GAACCTCTTCACCCAGTTCGCCATCGTCAATCCCATGCGCTACTACCGCATGATGGAGGTCGCCCCGAAGATGAAGGAGG
GCCTCAAGAAGCTTCAAACGGACCTCAACGTGACGGGCGCCGCGGTGGACAAGCTCGAGGACAACTTCACGACGCTGATG
CGGCTGCAGCACCCGCTGGAGCAGATTGACAAGGCGGGCGGCCTGGCCAGCGGTCCCATGTTGTTCACCGCGACCACGAA
GGCGAAGTAG