Detailed information of effector


Summary

Effector ID EFF01472 experimental
Effector type Tle
Cognate immunity protein IMU00295 experimental
Related T6SS (Type) T6SS00061 experimental (Type i4b)
Strain Acinetobacter baylyi ADP1
Replicon chromosome
Sequence Protein sequence (577 a.a.); Nucleotide sequence (1731 bp)
Description Tle1 (ACIAD3425) was predicted tobe a phospholipase belonging to family 4 of T6SS-associated phospholipases. It matches an alpha/beta-hydrolase fold (Gene3D 3.40.50.1820) and the abhydrolase_5 domain (PF12695.5).
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ACIAD_RS15495
Coordinates (Strand) 3339596..3341326 (-)
NCBI ID 50086393
RefSeq NC_005966
Uniprot ID UPI00003B7DDB
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-576 MANKTIAQTGSATSPTTNKSGTYVEVPLQDTIPIIFVPGIMGSNIFNTVLGKPVWMIGNGISGQVKTLTKQMGKTPAELQTELDPLNTRVDTSGDIKVDRRLKLTEKTLRERYWGTVHWDSYGGILTYLQMVLNNVDLNEKPIYTTGLGGGYAAVQQMKQQEAVYEWKSLLNQTESSKWFPQQSFVPINQQEIEHLKKFHFPVYAMGYNWLQSSENGAALVAQKLDKIKQEYGARFHKFIIVTHSMGGLLTRRLVQLCSADIAGVVHGVMPAEGAAAAYRRIVAGSGDVGALPAYVLGKNTEHVTAVLANAPGGLELLPTKAYNSGKPWLFLNGSGLINGKDLQKNVVSLPKNDPYEEIYKADGVWWEMVKDELVDPAKLIKKDNPNQRAKDVYFKKIEKVKEFHSKITNKYHPCTYVNYGDDSKHLSFGTLTWTLDRPLRGLTAEQMKRLPRATAKQIGTYRQKIVQEQMVKIKEGKGTDANNRDLALENDGIRYISLVNGNLGVFSISNQDAAGDGTVPHQSGSAPLKQSGVKQVFKMTGFDHQGSYNNTQVKRSVLYSIVKIIKENNIQPKFR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9250 - -



  Protein sequence: 577 a.a.    .

>EFF01472 NC_005966:c3341326-3339596 [Acinetobacter baylyi ADP1]
MANKTIAQTGSATSPTTNKSGTYVEVPLQDTIPIIFVPGIMGSNIFNTVLGKPVWMIGNGISGQVKTLTKQMGKTPAELQ
TELDPLNTRVDTSGDIKVDRRLKLTEKTLRERYWGTVHWDSYGGILTYLQMVLNNVDLNEKPIYTTGLGGGYAAVQQMKQ
QEAVYEWKSLLNQTESSKWFPQQSFVPINQQEIEHLKKFHFPVYAMGYNWLQSSENGAALVAQKLDKIKQEYGARFHKFI
IVTHSMGGLLTRRLVQLCSADIAGVVHGVMPAEGAAAAYRRIVAGSGDVGALPAYVLGKNTEHVTAVLANAPGGLELLPT
KAYNSGKPWLFLNGSGLINGKDLQKNVVSLPKNDPYEEIYKADGVWWEMVKDELVDPAKLIKKDNPNQRAKDVYFKKIEK
VKEFHSKITNKYHPCTYVNYGDDSKHLSFGTLTWTLDRPLRGLTAEQMKRLPRATAKQIGTYRQKIVQEQMVKIKEGKGT
DANNRDLALENDGIRYISLVNGNLGVFSISNQDAAGDGTVPHQSGSAPLKQSGVKQVFKMTGFDHQGSYNNTQVKRSVLY
SIVKIIKENNIQPKFR*

  Nucleotide sequence: 1731 bp    .

>EFF01472 NC_005966:c3341326-3339596 [Acinetobacter baylyi ADP1]
ATGGCGAACAAAACTATTGCACAAACAGGGTCAGCCACTAGTCCAACGACCAATAAGTCTGGAACTTATGTAGAGGTGCC
TTTACAGGACACAATCCCAATTATTTTTGTACCTGGAATTATGGGTTCAAATATTTTTAATACTGTTTTGGGTAAGCCAG
TCTGGATGATTGGTAATGGTATTTCTGGTCAAGTTAAAACCTTAACCAAACAGATGGGAAAAACTCCTGCTGAGCTACAG
ACAGAGTTAGACCCTTTAAATACAAGAGTAGATACAAGTGGTGATATAAAAGTTGACCGACGACTAAAACTTACCGAAAA
AACACTGCGGGAACGTTATTGGGGAACTGTACATTGGGATAGTTATGGTGGAATTCTAACTTATTTGCAAATGGTATTAA
ATAACGTCGATTTAAATGAAAAACCGATTTATACAACCGGCTTGGGAGGAGGATATGCTGCCGTTCAACAAATGAAACAG
CAAGAGGCAGTTTATGAGTGGAAAAGTTTACTGAATCAAACTGAATCCTCAAAATGGTTTCCACAACAATCATTTGTGCC
GATTAATCAACAAGAGATAGAACATCTTAAAAAATTCCATTTTCCCGTCTATGCGATGGGGTATAACTGGCTACAGTCGA
GTGAAAACGGTGCAGCGCTTGTTGCTCAAAAACTAGATAAAATAAAGCAAGAATATGGTGCACGCTTTCATAAATTTATT
ATCGTAACTCACTCTATGGGTGGCCTTTTAACGCGTAGATTAGTTCAATTGTGTAGTGCTGATATTGCAGGTGTGGTACA
TGGAGTAATGCCTGCTGAAGGCGCAGCAGCAGCTTATCGTCGTATTGTGGCAGGCTCTGGTGATGTCGGTGCTTTGCCAG
CCTATGTTCTTGGTAAAAATACTGAACATGTGACTGCGGTACTTGCAAATGCGCCAGGTGGTTTAGAACTGTTACCAACC
AAAGCTTATAACAGTGGAAAGCCATGGTTATTCTTAAACGGCTCAGGATTAATAAATGGAAAAGACTTACAAAAGAACGT
TGTATCTCTTCCGAAAAATGATCCATATGAAGAGATTTATAAGGCCGATGGGGTTTGGTGGGAAATGGTTAAGGATGAAC
TAGTTGATCCTGCCAAGTTAATTAAGAAAGATAATCCTAATCAGAGAGCCAAAGATGTATATTTCAAAAAAATTGAGAAA
GTAAAAGAATTTCATTCTAAGATTACCAATAAATATCATCCATGTACTTATGTTAACTATGGAGATGACTCTAAACATTT
AAGTTTTGGAACACTTACATGGACGTTAGATCGACCATTACGGGGATTAACTGCTGAACAAATGAAGAGGTTACCAAGAG
CGACAGCAAAGCAAATAGGTACATATCGTCAAAAAATTGTTCAAGAACAAATGGTCAAAATTAAAGAGGGCAAAGGTACA
GATGCGAACAATCGTGACTTAGCACTTGAGAATGATGGTATCCGCTATATCTCGTTAGTAAATGGTAATCTGGGTGTCTT
TTCAATCTCCAATCAAGACGCAGCTGGAGATGGTACCGTACCGCACCAGTCTGGTTCTGCTCCACTAAAACAGTCTGGCG
TTAAACAAGTATTTAAAATGACAGGTTTTGATCATCAAGGGAGTTATAACAATACTCAAGTTAAACGCTCAGTCTTATAT
TCAATAGTAAAGATCATTAAAGAGAATAATATTCAGCCAAAATTTAGATGA