Detailed information of effector


Summary

Effector ID EFF01463 experimental
Effector type Tle
Cognate immunity protein IMU00314 experimental
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (570 a.a.); Nucleotide sequence (1710 bp)
Description TplE encodes a PGAP1-like domain and can lead to induction of autophagy flux in human epithelial cells.
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA1510
Coordinates (Strand) 1639791..1641500 (-)
NCBI ID 15596707
RefSeq NC_002516
Uniprot ID Q9I3K2_PSEAE
KEGG ID pae:PA1510
PDB ID 4R1D, 5H7Y

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-569 MSSEPLEPNQDVIIPRSRDSLGRPVYKAQLTRTDNQSEKVALIRQTAPLPVIFIPGIMGTNLRNKADKSEVWRPPNGLWPMDDLFASIGALWTWAWRGPKARQELLKAEQVEVDDQGTIDVGQSGLSEEAARLRGWGKVMRSAYNPVMGLMERRLDNIVSRRELQAWWNDEALSPPGDQGEEQGKVGPIDEEELLRASRYQFDVWCAGYNWLQSNRQSALDVRDYIENTVLPFYQKECGLDPEQMRRMKVILVTHSMGGLVARALTQLHGYERVLGVVHGVQPATGSSTIYHHMRCGYEGIAQVVLGRNAGEVTAIVANSAGALELAPSAEYREGRPWLFLCDAQGQVLKDIDGKPRAYPQNQDPYEEIYKNTTWYGLVPEQNSQYLDMSDKKEGLRVGPRDNFEDLIDSIANFHGELSAAGYHSETYAHYGADDSRHSWRDLIWKGDPTPLETPGATLNDDENGTYNSWFRRGLPTIVQGPLETGNPLDASGSGGDETVPTDSGQAPALAGVKASFRHGSKGKGQANTKRGYEHQESYNDARAQWAALYGVIKITQLADWHPNDKGGT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9807 - -



  Protein sequence: 570 a.a.    .

>EFF01463 NC_002516:c1641500-1639791 [Pseudomonas aeruginosa PAO1]
MSSEPLEPNQDVIIPRSRDSLGRPVYKAQLTRTDNQSEKVALIRQTAPLPVIFIPGIMGTNLRNKADKSEVWRPPNGLWP
MDDLFASIGALWTWAWRGPKARQELLKAEQVEVDDQGTIDVGQSGLSEEAARLRGWGKVMRSAYNPVMGLMERRLDNIVS
RRELQAWWNDEALSPPGDQGEEQGKVGPIDEEELLRASRYQFDVWCAGYNWLQSNRQSALDVRDYIENTVLPFYQKECGL
DPEQMRRMKVILVTHSMGGLVARALTQLHGYERVLGVVHGVQPATGSSTIYHHMRCGYEGIAQVVLGRNAGEVTAIVANS
AGALELAPSAEYREGRPWLFLCDAQGQVLKDIDGKPRAYPQNQDPYEEIYKNTTWYGLVPEQNSQYLDMSDKKEGLRVGP
RDNFEDLIDSIANFHGELSAAGYHSETYAHYGADDSRHSWRDLIWKGDPTPLETPGATLNDDENGTYNSWFRRGLPTIVQ
GPLETGNPLDASGSGGDETVPTDSGQAPALAGVKASFRHGSKGKGQANTKRGYEHQESYNDARAQWAALYGVIKITQLAD
WHPNDKGGT*

  Nucleotide sequence: 1710 bp    .

>EFF01463 NC_002516:c1641500-1639791 [Pseudomonas aeruginosa PAO1]
ATGAGCAGCGAACCGCTCGAGCCGAATCAGGATGTGATCATCCCTCGCTCTCGCGACAGTCTGGGACGGCCTGTCTACAA
GGCGCAGTTGACCCGTACCGACAACCAGAGCGAAAAGGTGGCACTGATTCGGCAGACCGCTCCCCTGCCGGTGATCTTCA
TTCCGGGGATCATGGGAACCAACCTGCGCAACAAGGCAGATAAAAGCGAGGTCTGGAGGCCGCCGAATGGTCTGTGGCCC
ATGGATGACCTGTTTGCCTCCATCGGTGCGTTGTGGACTTGGGCCTGGAGGGGTCCAAAGGCCCGTCAGGAGCTCCTGAA
GGCTGAGCAAGTAGAAGTCGATGACCAGGGTACGATCGATGTCGGTCAATCTGGTTTGTCCGAAGAAGCTGCCCGCCTGC
GCGGCTGGGGCAAGGTCATGCGCAGTGCGTATAACCCGGTCATGGGATTAATGGAGAGGCGACTGGATAACATCGTCAGC
CGGCGGGAACTCCAGGCATGGTGGAATGACGAAGCCCTCTCTCCTCCTGGAGATCAGGGTGAGGAGCAGGGAAAGGTTGG
GCCGATCGATGAAGAGGAATTGCTCAGGGCCAGCCGATACCAGTTCGATGTCTGGTGCGCCGGCTATAACTGGCTACAGT
CCAACCGGCAGTCGGCGCTGGATGTACGCGACTATATCGAGAATACCGTGTTGCCTTTCTACCAAAAGGAGTGCGGTCTC
GATCCCGAGCAGATGAGACGTATGAAGGTCATTCTGGTCACCCATTCGATGGGAGGGCTGGTGGCTCGCGCCCTGACGCA
GTTGCACGGCTATGAGCGCGTATTGGGGGTGGTGCATGGCGTACAACCTGCGACAGGTTCCTCGACCATCTACCATCATA
TGCGCTGTGGCTATGAAGGTATCGCACAGGTCGTGCTGGGGCGAAATGCCGGTGAAGTGACAGCCATTGTCGCCAATTCG
GCCGGCGCGCTGGAATTGGCCCCTAGCGCGGAATACCGGGAAGGGCGTCCCTGGCTGTTTCTATGCGACGCGCAGGGGCA
GGTGCTCAAGGATATCGATGGAAAGCCTCGGGCTTATCCGCAGAATCAGGACCCTTATGAAGAGATATACAAGAACACTA
CGTGGTATGGATTGGTGCCTGAGCAAAATTCACAATATCTGGACATGTCAGACAAAAAAGAAGGTTTAAGAGTTGGCCCC
CGTGATAACTTTGAAGACTTGATAGATAGCATTGCTAATTTTCATGGTGAATTATCAGCAGCAGGATATCACTCAGAGAC
CTATGCCCATTACGGAGCTGACGATAGCCGCCATAGTTGGCGCGACCTGATCTGGAAGGGTGACCCTACCCCTCTGGAGA
CCCCCGGTGCCACACTCAACGACGATGAGAACGGCACTTACAACAGTTGGTTCCGCCGGGGCTTGCCCACCATAGTGCAG
GGTCCGCTGGAGACGGGAAATCCTCTGGACGCTTCCGGTAGCGGAGGTGACGAAACGGTACCGACCGACTCCGGCCAGGC
GCCTGCCCTGGCGGGCGTCAAGGCCAGCTTTCGGCATGGCAGCAAGGGCAAGGGACAGGCCAATACCAAACGGGGCTATG
AGCACCAGGAGAGTTACAACGATGCTCGTGCTCAATGGGCAGCGCTATATGGGGTGATCAAAATCACCCAGTTGGCGGAT
TGGCATCCTAATGACAAAGGAGGGACATGA