Detailed information of effector


Summary

Effector ID EFF01457 experimental
Effector type Tme
Cognate immunity protein IMU00339 experimental
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (1170 a.a.); Nucleotide sequence (3510 bp)
Description V12G01_16152 contains an N-terminal MIX motifbelonging to the MIX IV clan and a C-terminal pore-forming colicin-like domain
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_RS33215
Coordinates (Strand) 51252..54761 (-)
NCBI ID 491519127
RefSeq NZ_CH902590
Uniprot ID UPI0000D52918
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-870 MNNPLPPKTSMFWYDNSYTYEEAVQAFESDGTLKSLNIVPTTESDDLAGSPPERSMFWEGETKKIDPPPPSEPEPLNLKTEKEATEASPAHFIPVRYAIDQLETEETQPFGLPEEWKGQGPAKLNTVGYTLRQLRDGWLYVYDAINKSLDEYEIKGTQFTLYKLGESESPKSEQRGTPQDAKPFLTYVNGSVLSICFSEHRWTWHTFMRVLNNPSNHIDRMQTIVLSSNENQHNIASIDKLTQVADIESSAVDDGRFADSGITTKADEYGSVFKPVAAESDLTSAIPEEESGYFVAIKDYAADIQDMSLHFVGAASPYRLFTDQFSNQWNLMQTAMQLCMFGASDNIDMPTGVKRKNQELEFYMDMADYYDNSTMVDITSESQAAIIKGMPSSFSQQAIDDYQKSTSEIAEAIQKKYGISANRFGKYEQWIATERWRQQLNWKQMLSEMKELSEQKENMLTQVVSVKRDFIAVMESLTPHHLERTFDLYSEDTQYSLYQLHKQAVESFTLVIQEEDRQWAESQWEKPTSLLALYASGFSRSLFKVMEKNITEALDEQSIVSENPDPDNQLMDQISDTGNRVNMYSKIMDFVSNPNTAETAFLKDIAKGFQELDIIFKSAIGALAKGVVEFGVSMTSQVSISLMPVFAKPLNRHSYYLFAVIAEHMAHNMPVTVNESYARDFKKWKTRVNDYPSELKKNDAVIADFQKNNRKADSKYTTALKNKKRIKKALAVATLEYPQYIELPDDLPQRTIELRTRIAMNKLNDLNKLFENAGGLGFMALVFNCIALGDAMSSIQDTGLMSSDEFLDIQQKLLYTANAWTGIRTGKLWDSVKGDPRLRSHSYKALKELVNNNARGFDNLILDDLKVFNK
Transmembrane helix 871-888 WLAVTGVIGALASGIEAY
Inside 889-908 RSWKNIDGLHGSARVVEYFN
Transmembrane helix 909-931 FASLVGLTLVGGFQAIGGLTGIW
Outside 932-934 SAN
Transmembrane helix 935-954 ILFGGPIMFVIMGLTAVYLL
Inside 955-1169 SNHIMSKLKQDDYQKWLDKLPWGYHPDKALWSQSSSLVEREKHNSSLVQEALFELKTIMDKPLICQIPLMRTVPNSTTQYPAAKQELFGIELHIQVPTNTARDGIKLRTNTSVTEGGLGSGAWHTGVDLETLDSSTDSSDSQSVYKLTLPMKDSAKYLAFEIEYILDEKSEFNRKYWFQNNAKQRATYTAISDNTKQATIRSSLSSINSELSLQE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9852 - -



  Protein sequence: 1170 a.a.    .

>EFF01457 NZ_CH902590:c54761-51252 [Vibrio alginolyticus 12G01]
MNNPLPPKTSMFWYDNSYTYEEAVQAFESDGTLKSLNIVPTTESDDLAGSPPERSMFWEGETKKIDPPPPSEPEPLNLKT
EKEATEASPAHFIPVRYAIDQLETEETQPFGLPEEWKGQGPAKLNTVGYTLRQLRDGWLYVYDAINKSLDEYEIKGTQFT
LYKLGESESPKSEQRGTPQDAKPFLTYVNGSVLSICFSEHRWTWHTFMRVLNNPSNHIDRMQTIVLSSNENQHNIASIDK
LTQVADIESSAVDDGRFADSGITTKADEYGSVFKPVAAESDLTSAIPEEESGYFVAIKDYAADIQDMSLHFVGAASPYRL
FTDQFSNQWNLMQTAMQLCMFGASDNIDMPTGVKRKNQELEFYMDMADYYDNSTMVDITSESQAAIIKGMPSSFSQQAID
DYQKSTSEIAEAIQKKYGISANRFGKYEQWIATERWRQQLNWKQMLSEMKELSEQKENMLTQVVSVKRDFIAVMESLTPH
HLERTFDLYSEDTQYSLYQLHKQAVESFTLVIQEEDRQWAESQWEKPTSLLALYASGFSRSLFKVMEKNITEALDEQSIV
SENPDPDNQLMDQISDTGNRVNMYSKIMDFVSNPNTAETAFLKDIAKGFQELDIIFKSAIGALAKGVVEFGVSMTSQVSI
SLMPVFAKPLNRHSYYLFAVIAEHMAHNMPVTVNESYARDFKKWKTRVNDYPSELKKNDAVIADFQKNNRKADSKYTTAL
KNKKRIKKALAVATLEYPQYIELPDDLPQRTIELRTRIAMNKLNDLNKLFENAGGLGFMALVFNCIALGDAMSSIQDTGL
MSSDEFLDIQQKLLYTANAWTGIRTGKLWDSVKGDPRLRSHSYKALKELVNNNARGFDNLILDDLKVFNKWLAVTGVIGA
LASGIEAYRSWKNIDGLHGSARVVEYFNFASLVGLTLVGGFQAIGGLTGIWSANILFGGPIMFVIMGLTAVYLLSNHIMS
KLKQDDYQKWLDKLPWGYHPDKALWSQSSSLVEREKHNSSLVQEALFELKTIMDKPLICQIPLMRTVPNSTTQYPAAKQE
LFGIELHIQVPTNTARDGIKLRTNTSVTEGGLGSGAWHTGVDLETLDSSTDSSDSQSVYKLTLPMKDSAKYLAFEIEYIL
DEKSEFNRKYWFQNNAKQRATYTAISDNTKQATIRSSLSSINSELSLQE*

  Nucleotide sequence: 3510 bp    .

>EFF01457 NZ_CH902590:c54761-51252 [Vibrio alginolyticus 12G01]
ATGAATAATCCACTTCCTCCAAAAACTTCTATGTTCTGGTATGACAACAGCTATACCTATGAGGAGGCCGTTCAGGCATT
TGAAAGCGATGGTACACTGAAATCGCTGAATATCGTTCCAACCACGGAATCCGATGATCTTGCTGGCTCCCCCCCAGAGC
GCAGTATGTTTTGGGAGGGAGAAACAAAAAAAATCGATCCGCCACCGCCGTCTGAACCAGAGCCTCTCAATTTAAAAACT
GAGAAAGAAGCAACGGAAGCATCACCTGCGCACTTTATCCCAGTCCGCTATGCCATCGATCAGCTAGAAACAGAAGAGAC
ACAACCTTTTGGTTTGCCTGAAGAATGGAAAGGCCAAGGCCCAGCCAAACTCAATACCGTTGGTTACACCCTGCGTCAAC
TGCGCGACGGTTGGCTGTATGTCTATGATGCAATCAACAAAAGCTTAGACGAATACGAAATCAAAGGAACGCAATTCACG
CTCTATAAGTTGGGAGAATCAGAAAGCCCAAAATCAGAGCAGCGTGGGACACCACAAGATGCAAAGCCCTTTCTTACTTA
CGTCAACGGAAGCGTACTATCGATTTGCTTCTCTGAGCACCGCTGGACATGGCACACGTTCATGCGCGTACTTAACAATC
CGAGTAATCATATCGATCGCATGCAAACCATTGTTCTGTCCTCAAACGAGAACCAGCACAACATTGCATCAATAGATAAG
TTAACCCAAGTCGCTGATATTGAATCTTCTGCCGTCGATGATGGTCGCTTTGCGGATTCTGGCATCACAACCAAAGCCGA
TGAATATGGTTCCGTCTTTAAACCTGTCGCAGCCGAGAGTGACTTAACCTCTGCGATTCCAGAAGAAGAGTCAGGCTACT
TCGTCGCGATAAAAGATTACGCCGCAGACATTCAAGATATGTCACTGCATTTTGTTGGTGCCGCAAGCCCTTACCGCCTT
TTCACTGACCAGTTTTCAAACCAGTGGAACTTGATGCAGACCGCCATGCAGCTGTGCATGTTCGGGGCAAGCGACAATAT
AGACATGCCTACAGGAGTAAAGCGCAAAAACCAAGAGCTTGAATTCTATATGGACATGGCGGATTACTATGACAACTCAA
CAATGGTTGACATTACCAGTGAATCTCAAGCAGCTATCATCAAAGGAATGCCGTCTTCATTTTCCCAGCAAGCTATCGAT
GATTACCAAAAGTCCACTTCAGAAATAGCAGAGGCCATACAGAAAAAATATGGCATTTCAGCAAACCGATTTGGTAAATA
CGAACAATGGATAGCGACTGAACGCTGGCGTCAGCAGCTCAACTGGAAGCAAATGCTGAGCGAGATGAAAGAGCTGTCAG
AACAAAAAGAAAACATGCTAACCCAAGTGGTTTCGGTCAAACGCGACTTTATCGCAGTAATGGAGTCCTTAACGCCGCAT
CATCTCGAAAGAACCTTCGACCTATACAGCGAAGACACGCAGTACAGCTTGTATCAACTGCACAAGCAAGCGGTTGAGTC
ATTTACTCTGGTGATACAAGAAGAAGACCGCCAATGGGCTGAAAGCCAATGGGAGAAACCAACCAGTTTACTTGCTCTCT
ATGCCTCTGGGTTTAGTCGTAGTTTATTTAAAGTGATGGAGAAGAATATTACAGAGGCGCTTGATGAACAGTCGATCGTC
TCAGAAAACCCTGATCCTGATAATCAGTTGATGGACCAGATATCTGATACCGGCAACCGCGTGAATATGTACTCTAAGAT
CATGGACTTTGTTTCCAACCCAAACACTGCGGAAACAGCCTTTCTCAAAGATATCGCCAAAGGTTTCCAAGAGCTGGATA
TTATTTTTAAATCTGCAATAGGTGCGCTTGCAAAAGGCGTTGTAGAGTTTGGTGTTAGCATGACCTCACAAGTATCAATT
TCGCTGATGCCTGTTTTCGCTAAACCTCTGAACCGTCATAGCTATTATTTATTTGCCGTTATTGCAGAACATATGGCACA
CAATATGCCTGTTACTGTAAATGAAAGCTACGCTCGCGATTTTAAAAAATGGAAAACACGCGTAAATGATTACCCAAGTG
AGCTCAAGAAAAACGATGCGGTCATTGCTGACTTCCAGAAAAACAACCGCAAAGCCGACTCTAAATACACAACAGCTTTA
AAAAATAAAAAGAGAATTAAGAAGGCACTCGCTGTAGCTACATTGGAGTACCCACAGTACATTGAGTTACCTGATGATCT
ACCTCAAAGAACCATCGAGCTTAGAACGCGGATCGCTATGAATAAGCTCAATGATTTGAATAAACTGTTCGAGAATGCCG
GTGGTCTAGGCTTTATGGCATTAGTATTTAACTGCATCGCGCTTGGTGATGCCATGAGTAGTATCCAAGACACTGGGTTA
ATGTCCTCAGATGAATTTTTAGATATCCAGCAAAAGCTTTTATATACAGCCAACGCTTGGACGGGGATTCGCACGGGTAA
ATTATGGGATAGTGTGAAGGGTGATCCTCGGTTAAGGTCACATTCATATAAAGCATTAAAAGAGTTAGTAAATAATAATG
CCCGTGGTTTTGATAACTTGATCCTTGATGACTTAAAGGTATTCAATAAATGGCTAGCTGTGACCGGAGTTATTGGAGCT
CTTGCTTCGGGTATAGAGGCCTATCGTTCATGGAAGAACATAGACGGTTTACATGGGAGCGCAAGAGTTGTCGAATACTT
CAACTTTGCATCTTTAGTTGGATTGACACTTGTAGGTGGGTTTCAAGCTATCGGTGGATTAACTGGGATTTGGTCTGCAA
ATATTCTGTTTGGAGGTCCGATCATGTTTGTCATTATGGGCCTTACTGCAGTTTACCTTCTTAGTAATCATATAATGAGT
AAACTTAAACAAGATGATTATCAAAAGTGGTTAGATAAACTTCCTTGGGGCTATCACCCAGATAAAGCCCTGTGGAGTCA
ATCCTCAAGCTTGGTAGAGAGAGAAAAGCATAATTCCTCTTTAGTGCAAGAGGCTCTTTTTGAGTTAAAAACCATAATGG
ATAAACCTTTGATCTGCCAAATACCATTGATGCGTACCGTTCCGAATTCAACAACACAGTATCCGGCAGCAAAACAAGAA
TTGTTTGGTATTGAGCTACATATCCAAGTTCCCACCAATACAGCAAGAGATGGAATAAAACTTCGGACAAATACTTCTGT
AACAGAGGGAGGACTGGGGTCGGGAGCTTGGCACACTGGAGTAGATCTAGAAACGTTGGATAGTTCAACAGATTCCTCAG
ATTCTCAAAGTGTCTATAAATTGACTTTACCAATGAAAGACTCGGCTAAATATTTAGCATTTGAGATAGAATACATTCTT
GATGAGAAGAGCGAATTTAACCGTAAGTACTGGTTCCAAAATAATGCAAAACAGCGTGCAACTTATACAGCAATTTCAGA
CAATACCAAACAAGCAACGATCAGAAGTTCATTATCTTCGATTAATAGTGAACTTAGCTTACAGGAGTAA