Detailed information of effector


Summary

Effector ID EFF01456 experimental
Effector type Tme
Cognate immunity protein IMU00338 experimental
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (321 a.a.); Nucleotide sequence (963 bp)
Description V12G01_03175 possess pore-forming colicin-like domains
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_RS27070
Coordinates (Strand) 494035..494997 (+)
NCBI ID 491516494
RefSeq NZ_CH902589
Uniprot ID A0A0P7EX22_VIBAL
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-320 MVLTHIMTLNKHISDPNRIRAGDIIWLSALPKSSSQLKTQSNNALPPKSIAKLGIYPASKPQMPSSPPHKVLPPNLLSYNQPPKSISNQVPPQHADMFWALAWLENNANMITIPGGTLMGATGNLMSKGNIKLIENINDLYANYKNGVISKGQYDGRRKKHLDLLKKNVGPMEKLLFGNKTTHQSIRIARSGGLPANAHIVKQAEKLNKIAQASKVGGHVLVGVGLTASCIQIANTQDQHEKNEIFVESITSTAVGMGTSALVGLFLVSNPIGWGTAIVLAAGSTAVGYASGKVAKSFYNSIESKPNLVASTGIESICSK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9185 - -



  Protein sequence: 321 a.a.    .

>EFF01456 NZ_CH902589:494035-494997 [Vibrio alginolyticus 12G01]
MVLTHIMTLNKHISDPNRIRAGDIIWLSALPKSSSQLKTQSNNALPPKSIAKLGIYPASKPQMPSSPPHKVLPPNLLSYN
QPPKSISNQVPPQHADMFWALAWLENNANMITIPGGTLMGATGNLMSKGNIKLIENINDLYANYKNGVISKGQYDGRRKK
HLDLLKKNVGPMEKLLFGNKTTHQSIRIARSGGLPANAHIVKQAEKLNKIAQASKVGGHVLVGVGLTASCIQIANTQDQH
EKNEIFVESITSTAVGMGTSALVGLFLVSNPIGWGTAIVLAAGSTAVGYASGKVAKSFYNSIESKPNLVASTGIESICSK
*

  Nucleotide sequence: 963 bp    .

>EFF01456 NZ_CH902589:494035-494997 [Vibrio alginolyticus 12G01]
ATGGTACTGACTCATATAATGACATTAAACAAGCATATTTCAGATCCTAACCGCATTAGAGCAGGCGATATCATTTGGTT
ATCAGCTCTACCCAAATCAAGCTCTCAACTTAAAACTCAAAGTAACAATGCGTTACCTCCTAAAAGTATCGCGAAGCTAG
GGATCTACCCAGCGTCTAAACCTCAAATGCCCAGCTCTCCTCCCCATAAAGTTTTGCCTCCCAATCTTCTCAGCTACAAT
CAACCTCCAAAATCAATCTCAAATCAAGTTCCACCGCAACATGCTGACATGTTTTGGGCGTTGGCATGGCTAGAAAACAA
CGCCAATATGATTACTATTCCAGGAGGTACCTTGATGGGTGCTACAGGGAACTTGATGAGTAAAGGAAATATTAAGCTCA
TTGAGAACATCAACGACCTTTACGCAAACTATAAAAACGGAGTAATAAGTAAAGGACAATATGATGGTCGACGTAAAAAA
CATTTAGACCTACTAAAGAAAAATGTTGGCCCTATGGAAAAGCTGTTATTTGGCAACAAAACGACTCACCAGTCTATTCG
CATAGCTCGAAGTGGAGGGTTACCTGCGAATGCTCATATAGTTAAACAAGCCGAAAAACTGAATAAAATAGCTCAAGCAT
CTAAAGTGGGCGGACATGTTTTAGTCGGTGTTGGTCTGACGGCTTCCTGCATTCAGATTGCGAATACACAAGACCAACAT
GAGAAGAATGAAATTTTTGTTGAGTCAATAACTAGCACAGCTGTAGGAATGGGTACCAGCGCGTTAGTCGGTCTATTTTT
AGTATCAAACCCTATTGGCTGGGGGACTGCCATTGTACTCGCTGCCGGTTCAACGGCTGTAGGTTATGCATCCGGTAAAG
TGGCAAAAAGCTTTTATAATTCAATTGAAAGCAAGCCAAACTTAGTCGCTAGTACTGGAATAGAGTCTATATGCAGCAAG
TAA