Detailed information of effector


Summary

Effector ID EFF01454 experimental
Effector type Tde
Cognate immunity protein IMU00336 experimental
Related T6SS (Type) T6SS00939 experimental (Type i5)
Strain Vibrio alginolyticus 12G01
Replicon chromosome
Sequence Protein sequence (240 a.a.); Nucleotide sequence (720 bp)
Description V12G01_16922 possess predicted nuclease
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) V12G01_RS33945
Coordinates (Strand) 213122..213841 (+)
NCBI ID 491519344
RefSeq NZ_CH902590
Uniprot ID UPI0000D544CE
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AHH PF14412.8 2.1e-11 117..208

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-239 MEKVILGKSPVLKLPLRPKNPSGLEMAIYRFQVKAYKHYHKIKDLDKTSPKEVKEAEETVAHLNRERAKINAHAQLQEQLLADLEAYRDDNKDKSSPELGMENHHPTNRLVSNLYAVSEPQPSPNHAAHHIVMGNGRVRAMTDARLQMFMFGIGINDSMNGIWLPRSTAYKGHYTTPNAPTHSRIHGNNYQRWVGKLADIRHNESAFKSRLVRIKSQLKDGSYPPQILMKKDPTWNPPE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9933 - -



  Protein sequence: 240 a.a.    .

>EFF01454 NZ_CH902590:213122-213841 [Vibrio alginolyticus 12G01]
MEKVILGKSPVLKLPLRPKNPSGLEMAIYRFQVKAYKHYHKIKDLDKTSPKEVKEAEETVAHLNRERAKINAHAQLQEQL
LADLEAYRDDNKDKSSPELGMENHHPTNRLVSNLYAVSEPQPSPNHAAHHIVMGNGRVRAMTDARLQMFMFGIGINDSMN
GIWLPRSTAYKGHYTTPNAPTHSRIHGNNYQRWVGKLADIRHNESAFKSRLVRIKSQLKDGSYPPQILMKKDPTWNPPE*

  Nucleotide sequence: 720 bp    .

>EFF01454 NZ_CH902590:213122-213841 [Vibrio alginolyticus 12G01]
ATGGAAAAGGTAATTTTGGGCAAGTCTCCCGTTCTGAAGCTCCCTTTGAGGCCAAAGAACCCGTCAGGCTTGGAGATGGC
GATATATAGATTTCAGGTTAAAGCGTACAAGCATTACCACAAGATAAAGGATCTAGATAAAACCTCGCCTAAAGAGGTTA
AAGAAGCAGAGGAAACCGTTGCTCATTTGAATCGAGAGCGTGCCAAGATTAACGCGCATGCACAATTGCAAGAGCAGTTG
CTTGCAGATTTAGAAGCGTATCGAGATGATAACAAAGATAAATCTAGTCCCGAGCTGGGGATGGAAAATCACCATCCTAC
AAATCGCTTGGTAAGTAACTTGTATGCTGTTTCAGAGCCGCAACCGTCCCCAAATCATGCAGCACATCATATCGTTATGG
GTAATGGTCGAGTTAGGGCCATGACTGACGCTCGGTTGCAAATGTTCATGTTTGGGATAGGTATTAACGACTCAATGAAT
GGTATTTGGCTACCACGTTCGACCGCCTACAAGGGACATTATACTACGCCAAATGCACCAACGCATTCGCGCATACATGG
CAATAATTATCAGAGATGGGTTGGTAAATTGGCCGATATTCGTCACAATGAAAGCGCGTTTAAATCTAGACTTGTGAGAA
TCAAATCTCAGTTAAAGGATGGTTCTTACCCTCCCCAAATCCTTATGAAGAAAGACCCAACTTGGAACCCACCTGAATGA