Detailed information of effector


Summary

Effector ID EFF01451 experimental
Effector type Tse
Cognate immunity protein IMU00311 experimental
Related T6SS (Type) T6SS00926 experimental (Type iii)
Strain Bacteroides fragilis 638R
Replicon chromosome
Sequence Protein sequence (332 a.a.); Nucleotide sequence (996 bp)
Description Bfe1 (putative transmembrane protein)
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) BF638R_1988
Coordinates (Strand) 2345779..2346774 (-)
NCBI ID 301162963
RefSeq NC_016776
Uniprot ID E1WVU5_BACF6
KEGG ID bfg:BF638R_1988
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-278 MAYRNEYKTQSEFNVILERGDDYEGFVVGLGYTWMSSKVILPVNQNGWSPISRNVSVDESFHTIVSERKYDTSQYAYEKSLMQDPTKVSEKVRDLIVKNKGNNITEINLGQEKQYLPTDNSQISIVITDTGSRYEIVISATDNSNGKTYEAKYESLTDLVSAVRDSGSLPAVNKEGPNLEGLAGLGFGIAETAGNWAEKIMDNRGAYLPKQMRFSPKTLPPIIRLPLGNYQVPAKGMSRVRGVGKALGWAGMVLTGYQVVRDVQNGRFAVAGTRIAVA
Transmembrane helix 279-301 GLAYGVTFIPYVGWVLAIGIGVA
Outside 302-331 DYTWGDEFYDWIDNRASELEMWWDGVRLAL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9938 - -



  Protein sequence: 332 a.a.    .

>EFF01451 NC_016776:c2346774-2345779 [Bacteroides fragilis 638R]
MAYRNEYKTQSEFNVILERGDDYEGFVVGLGYTWMSSKVILPVNQNGWSPISRNVSVDESFHTIVSERKYDTSQYAYEKS
LMQDPTKVSEKVRDLIVKNKGNNITEINLGQEKQYLPTDNSQISIVITDTGSRYEIVISATDNSNGKTYEAKYESLTDLV
SAVRDSGSLPAVNKEGPNLEGLAGLGFGIAETAGNWAEKIMDNRGAYLPKQMRFSPKTLPPIIRLPLGNYQVPAKGMSRV
RGVGKALGWAGMVLTGYQVVRDVQNGRFAVAGTRIAVAGLAYGVTFIPYVGWVLAIGIGVADYTWGDEFYDWIDNRASEL
EMWWDGVRLAL*

  Nucleotide sequence: 996 bp    .

>EFF01451 NC_016776:c2346774-2345779 [Bacteroides fragilis 638R]
ATGGCTTATAGAAATGAATATAAAACGCAAAGTGAATTTAATGTCATCTTGGAACGGGGGGATGACTATGAAGGATTTGT
AGTTGGCTTGGGATATACTTGGATGAGTAGCAAGGTAATTCTACCGGTAAATCAAAACGGATGGAGTCCAATATCTCGGA
ATGTTTCGGTGGACGAGAGTTTTCATACGATAGTCTCAGAAAGGAAATACGATACCTCCCAATATGCCTATGAAAAAAGT
CTGATGCAAGATCCAACAAAAGTTTCCGAAAAGGTCCGTGACTTAATAGTTAAAAACAAAGGTAATAATATCACTGAGAT
AAATTTAGGCCAAGAAAAGCAATATTTGCCCACGGATAATAGTCAGATAAGTATTGTAATTACTGACACTGGCAGTCGGT
ACGAAATTGTGATTAGTGCCACGGATAACTCAAATGGAAAGACTTATGAGGCAAAGTATGAGAGTTTGACGGACTTGGTG
TCAGCGGTACGCGATTCTGGTAGCCTGCCTGCTGTAAATAAGGAAGGACCCAATCTGGAAGGACTGGCAGGGTTAGGATT
CGGAATTGCTGAAACAGCCGGAAATTGGGCTGAGAAGATTATGGATAATCGAGGTGCGTACTTACCTAAGCAGATGCGTT
TCTCGCCCAAAACGCTTCCGCCGATTATAAGATTGCCTTTAGGGAACTATCAAGTCCCCGCTAAAGGTATGAGTAGAGTG
CGTGGAGTAGGTAAAGCTTTGGGATGGGCAGGAATGGTGCTTACTGGCTATCAAGTTGTGCGTGATGTGCAAAATGGTCG
ATTTGCCGTGGCAGGTACAAGAATTGCCGTAGCAGGTTTAGCTTATGGCGTTACTTTTATTCCCTATGTCGGTTGGGTCT
TAGCTATCGGTATCGGAGTGGCTGATTATACTTGGGGTGACGAGTTCTATGACTGGATAGACAATAGAGCTTCTGAATTG
GAAATGTGGTGGGACGGTGTAAGATTAGCATTATGA