Detailed information of effector


Summary

Effector ID EFF01450 experimental
Effector type Tle
Cognate immunity protein IMU00315 experimental
Related T6SS (Type) T6SS00004 experimental (Type i1)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (717 a.a.); Nucleotide sequence (2151 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0260
Coordinates (Strand) 291154..293304 (-)
NCBI ID 15595457
RefSeq NC_002516
Uniprot ID Q9I6M9_PSEAE
KEGG ID pae:PA0260
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF3274 PF11678.10 5.6e-109 386..685

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-716 MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDLAGCYERIERGLCQGLNERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDVVYYRRKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFVNATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIRKRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWSSQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGQGCQTTIDGERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQRIFTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTAPRLPLPTEARFDFDGAVTAPGENSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVAQQVDAALAYRYGRDARSVERALNEGKELAQQTHVFSARELGTGMVLVTRAETPYEARLRLQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDWKASDKGIFSQGDASVDLPDEEVRALYRAEESKNSQLIDATVAYRKSGEFPVVVGNRLPSLVGTQTILDRYHEQAVRFGGTI



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8490 - -



  Protein sequence: 717 a.a.    .

>EFF01450 NC_002516:c293304-291154 [Pseudomonas aeruginosa PAO1]
MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDLAGCYERIERGLCQGLNERLDMPPTLPGGQANPGYL
TPAGYSLPADDEGKAENPDVVYYRRKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGG
QFVNATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIRKRYPDDTINVVGHSQGTL
LTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWSSQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQG
YGAIGGPGWVGGQGCQTTIDGERLSFDERDNRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQRI
FTVRKRNGEKEKIGGHAPPHVYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTAPRLPLPTEARFDFDGAVTAPGE
NSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVAQQVDAALAYRYGRDARSVERALNEGKELAQQTHVFSARELGTG
MVLVTRAETPYEARLRLQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDWKASDK
GIFSQGDASVDLPDEEVRALYRAEESKNSQLIDATVAYRKSGEFPVVVGNRLPSLVGTQTILDRYHEQAVRFGGTI*

  Nucleotide sequence: 2151 bp    .

>EFF01450 NC_002516:c293304-291154 [Pseudomonas aeruginosa PAO1]
ATGAACGATAGGGTTCGGTCGAGGACGATCGTCTCTGCCCAGTCCATCACCTTGCCCAAGGGCGGCGACGTGCACCTGGT
GCCGCCTCCGCCCAAGCCTTGCGTGACCATCGTGGTGCATGGCGTCAACGATCTCGCGGGTTGCTACGAACGGATCGAGC
GAGGGCTCTGCCAGGGGCTCAATGAACGCCTGGACATGCCGCCGACCTTGCCCGGCGGGCAGGCCAATCCCGGCTACCTG
ACGCCGGCGGGCTACAGCCTGCCGGCGGACGACGAAGGCAAGGCAGAGAACCCCGACGTCGTCTACTACCGGCGCAAGTT
CGCCAGTGGCGCCGGCGGGGCCGCCGTACGCAGCGTAGTCGTACCTTTCTACTGGGGCTTCCGCGAGGAAGAGCAATACA
TCAACAAGACCGCGGCCCACGGCGAATGGCTGGACCGCAACGGCAACCGGCTGGACAAGTCCGGCACCAAGGAAGGCGGG
CAGTTCGTCAATGCCACCACCAACCTGCCGGACATGTGGGGCCAGGGTTTCAACGGCAAGCTGTTCGGTTTCATCTCGCT
GGACTGGTTCGGCGGCACCATGACCCATCCGCTGTTTTCGGCGGCAGGGCGCAAGTACATGGTCCTTGCGGCCATGCGCC
TGGCCATGTTGATCAAGATCATCCGCAAGCGTTACCCGGACGACACCATCAATGTCGTCGGGCACAGCCAGGGCACCCTG
TTGACCCTGCTGGCACATGCCTTCCTCAAGGATGACGGCGTGGCGCCGGCGGACGGGGTGATCATGCTCAACTCACCCTA
CGGCCTGTTCGAACCCCTCAACGAGAAGCTCCAGGGCTGGAGCAGCCAGCAGACCAGAGAGGCGCGGCTGGCCACGCTCA
AAGGTATCCTCGAGTTCATCTGCGGCCGACGCCATCCGGTCCCCGCGCTGAGCAGCGTCGCGTTGCGCAACTGCCAAGGC
TACGGCGCGATAGGCGGCCCCGGCTGGGTGGGTGGCCAGGGCTGCCAGACGACCATCGACGGGGAACGGCTCAGCTTCGA
TGAGCGCGACAATCGCGGCAGTGTCTACCTGTATTTCACGCCCCAGGACCAGACGGTGGGACTTGCCAACGTCCAGGGTA
TCGGCTGGCGCGGCATTGCTGAGCAGGTCAAGGGGCTCCCGGGAAGGACCGGGCTGCCGCAGGGTTTTCACCAGCGCATC
TTCACCGTACGCAAGCGCAATGGCGAGAAGGAAAAGATCGGCGGGCACGCCCCTCCCCATGTCTATCCTCTTCTGCTGGC
CGGCGAGAAGACCTGGGAAGACACCGGGCTGGGCGGCAAGGACAGATTCGGCCGGGCGAACTTCGACCAGGGCGACAGCG
TGCTGCTGACTGCGCCGCGTCTGCCGTTGCCGACGGAAGCGCGATTCGATTTCGACGGAGCCGTCACGGCGCCGGGAGAG
AACTCCGCCAGCGGCGTCTATCAGGTGCGCGATACCCTCGATCCGATCGACGCCGCCATCGGCGTAAGCAACGGCGGCTG
GAAGGAAAAGGACAGCGGGCACGCCGTCGCGCAACAGGTGGACGCCGCGCTGGCGTACCGCTACGGGCGCGACGCGCGCA
GCGTGGAGAGGGCGTTGAACGAAGGCAAGGAATTGGCCCAGCAGACCCATGTGTTTTCCGCTCGTGAACTGGGCACCGGC
ATGGTTCTGGTCACCCGCGCGGAAACTCCCTACGAGGCCCGGCTGCGCCTGCAGACGGCGGAGGGCCATCTGGAGCCCTT
GTCGTTCCACTCGGCCATACCCAACAACCCGGAGCATAACCGGCGGGTACTGGCCTATGACCTGGCCATCGGGGCCGGGG
ACAGCGTGGATGATGTGGTTTTCTATCAGTATCTGTGTCGGGTGGCGGATTGGCGGTTGGATTGGAAGGCTTCGGACAAA
GGAATATTTAGTCAAGGTGATGCGTCTGTTGATCTGCCGGATGAAGAGGTGCGTGCTTTGTACCGTGCGGAAGAGTCTAA
AAACAGCCAGTTAATAGACGCCACCGTAGCTTACCGCAAGAGTGGCGAGTTCCCTGTGGTAGTAGGAAATAGACTGCCTT
CCCTAGTCGGGACACAAACCATCCTAGATCGTTACCACGAGCAGGCGGTGCGCTTTGGGGGGACAATCTAA