Detailed information of effector


Summary

Effector ID EFF01418 experimental
Effector type Tae
Cognate immunity protein IMU00269 experimental
Related T6SS (Type) T6SS00395 experimental (Type i3)
Strain Enterobacter cloacae subsp. cloacae ATCC 13047
Replicon chromosome
Sequence Protein sequence (164 a.a.); Nucleotide sequence (492 bp)
Description Wild-type ECL has a slight growth advantage over Δtae4 Δtai4 cells, which is abrogated when targets are provided with plasmid- borne tai4
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECL_01542 (Tae4)
Coordinates (Strand) 1563472..1563963 (+)
NCBI ID 502861206
RefSeq NC_014121
Uniprot ID A0A0M7EMX8_ENTCL, A0A0H3CIJ2_ENTCC
KEGG ID enc:ECL_01542
PDB ID 4HFK, 4HFL

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 6.2e-22 43..139

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-163 MSHMRPAFGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAGIFKNACPIRMSYVLNYCGIPVPSNSKYATVTGSDKKRYMFRVKDMIAFLPTVLGKADISVSSPTPAQFAGKQGIIIFTGHGWLDATGHVTLWNGNICSDDCHFLGSPGNGSFIPTNATFWSLK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9741 - -



  Protein sequence: 164 a.a.    .

>EFF01418 NC_014121:1563472-1563963 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSHMRPAFGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAGIFKNACPIRMSYVLNYCGIPVPSNSKYATVTGSDKKRYMF
RVKDMIAFLPTVLGKADISVSSPTPAQFAGKQGIIIFTGHGWLDATGHVTLWNGNICSDDCHFLGSPGNGSFIPTNATFW
SLK*

  Nucleotide sequence: 492 bp    .

>EFF01418 NC_014121:1563472-1563963 [Enterobacter cloacae subsp. cloacae ATCC 13047]
ATGTCTCATATGCGTCCTGCTTTTGGTGCCGCCTGGAACCGATTTAAAGAAGTGAACGTCAACGTAGAACAGGTTGGCAA
GTTATTGGGGGGGAAAGTTCAGCATAATATAGATGCTGGTATTTTTAAAAATGCCTGCCCCATTCGTATGAGCTATGTTT
TAAATTATTGTGGCATTCCAGTTCCTTCTAATAGTAAATATGCAACTGTGACCGGGAGCGACAAGAAGCGATATATGTTC
CGTGTTAAAGATATGATTGCTTTTTTACCCACGGTATTGGGAAAAGCTGACATATCTGTTTCTTCTCCAACCCCAGCACA
ATTTGCGGGCAAGCAAGGTATTATTATTTTTACCGGGCATGGCTGGCTTGATGCAACCGGGCATGTAACACTCTGGAACG
GAAATATTTGTTCGGATGATTGTCATTTCCTTGGCTCACCGGGTAATGGTTCATTTATCCCTACTAACGCAACCTTCTGG
AGCCTGAAATGA