Detailed information of effector


Summary

Effector ID EFF01370 experimental
Effector type Tae
Cognate immunity protein IMU00303 experimental
Related T6SS (Type) T6SS00535 experimental (Type i3)
Strain Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Replicon chromosome
Sequence Protein sequence (162 a.a.); Nucleotide sequence (486 bp)
Description Tae4_TM
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Benz J, Reinstein J, Meinhart A. Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium. PLoS One. 2013 Jun 27;8(6):e67362. doi: 10.1371/journal.pone.0067362. Print 2013. PMID: 23826277
[3] Ma J, Sun M, Dong W, et al. PAAR-Rhs proteins harbor various C-terminal toxins to diversify the antibacterial pathways of type VI secretion systems. Environ Microbiol. 2017 Jan;19(1):345-360. doi: 10.1111/1462-2920.13621. Epub 2017 Jan 18. PMID: 27871130
[4] Sana TG, Flaugnatti N, Lugo KA, et al. Salmonella Typhimurium utilizes a T6SS-mediated antibacterial weapon to establish in the host gut. Proc Natl Acad Sci U S A. 2016 Aug 23;113(34):E5044-51. doi: 10.1073/pnas.1608858113. Epub 2016 Aug 8. PMID: 27503894
[5] Sana TG, Flaugnatti N, Lugo KA, et al. Salmonella Typhimurium utilizes a T6SS-mediated antibacterial weapon to establish in the host gut. Proc Natl Acad Sci U S A. 2016 Aug 23;113(34):E5044-51. doi: 10.1073/pnas.1608858113. Epub 2016 Aug 8. PMID: 27503894
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) SL1344_RS01405
Coordinates (Strand) 317659..318144 (+)
NCBI ID 378698249
RefSeq NC_016810
Uniprot ID UPI00000D020F
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tae4 PF14113.8 2.1e-22 41..137

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-161 MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWILP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8623 - -



  Protein sequence: 162 a.a.    .

>EFF01370 NC_016810:317659-318144 [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRV
NDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWIL
P*

  Nucleotide sequence: 486 bp    .

>EFF01370 NC_016810:317659-318144 [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGGGTAGCATTAT
TGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCGAATGAGCTATGTTTTGAATG
CGACAGGGTTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGTGCCGATAATAAATTCTATATTTATCGCGTG
AATGATATGATTGATTATCTTACTCATACTATGGGCAAGCCTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTAT
CGGGAAGAAAGGAATTATCGTAGTAAAAGGGCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTA
TCTGTTCAGATCAGTGCCACTTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACACTGTGGATACTG
CCGTGA