Detailed information of effector


Summary

Effector ID EFF01348 experimental
Effector type Tle
Cognate immunity protein IMU00254 experimental
Related T6SS (Type) T6SS00904 experimental (Type i2)
Strain Escherichia coli strain TW-XM
Replicon chromosome
Sequence Protein sequence (590 a.a.); Nucleotide sequence (1770 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) xmoI (Tle4)
Coordinates (Strand) 11678..13447 (+)
NCBI ID 611963687
GenBank KF678349
Uniprot ID X5F6C2_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PGAP1 PF07819.15 7.4e-06 227..262

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-589 MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERKRLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDRGWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVHVVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGVLPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRDGSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVNPFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGRLDLNEVGNIRPIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYRNPVSQAFALRSIIKIAQEVKKDGKMSYSD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9950 - -



  Protein sequence: 590 a.a.    .

>EFF01348 KF678349:11678-13447 [Escherichia coli]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERKRLLHPDRVEV
DNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDRGWGEVANASYGSFLDVLQTA
LYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVHVVGYNWLGSNMLSAIRLQEQIKKIVGGYQK
RGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGVLPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEM
VAVFSQSPGPMELLPMNDYGEEWLNIVDRDGSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLN
QKQIDTDWNIYENLITESVNPFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGR
LDLNEVGNIRPIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYR
NPVSQAFALRSIIKIAQEVKKDGKMSYSD*

  Nucleotide sequence: 1770 bp    .

>EFF01348 KF678349:11678-13447 [Escherichia coli]
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTACGGGTTATTCC
GGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCATCTGGCGATATGATGACTCTA
TGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAAAGATTATTGCATCCTGACAGGGTGGAGGTC
GATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAGAAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCC
ATCCGATAAAGAAGCAATGGATAATTACACTCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTAT
TTGGTTCAAGAAAAGATCGCGGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCA
TTGTACCGGGACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCATGTCGTTGGCT
ATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAATTGTTGGAGGCTATCAAAAA
CGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGGACTAGTGGCAAGGTACTTTTCAGAGTGTCT
TTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTATTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGA
AACGTGGAACTGAAAACCCAGAGTCAAATCCGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATG
GTAGCTGTTTTTTCCCAGTCGCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGT
CGATCGTGATGGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGAAATTGGTGGATGAGAATCTATTGAATCCTTTTAATACTTCATTAAAT
CAAAAGCAAATTGATACTGATTGGAATATATATGAAAATTTAATTACTGAGAGTGTCAATCCATTTCATAAGCAAATTGC
TGGAAAATATCATATCAATACTTACTCTTTCTATGGGAGAGCGAAATTGGGAGATATTCCTGAAGCGCATTTAACGCAGG
AAAATGTTCTTTGGAAAGGCTCATTATCAATGGGAAAAAAAAGTGATATATCTTTAGAACCAAAATTCATTGATGGTCGT
CTTGATTTAAATGAAGTTGGTAACATTAGACCTATTAAGGATGAATTTTCTCCTGAAGAACAGGCGTGGGAAATAAATAC
TGACGACGGTGATACATATGTTAAGATAGGACAGCGTTTTACATTACGAGACTCTTGTGAAAACGGGGATGGTACAGTAC
CTCTTCGTGCAGGACAAATCGTACACAAGAACATCCTAGAGCGTTTGGCTGTACAGGTTTCTCACGAGGCTGCTTATCGA
AATCCCGTTAGTCAGGCATTTGCATTACGTTCTATTATAAAAATAGCTCAGGAGGTAAAAAAGGATGGTAAAATGTCATA
CTCTGATTAA