Detailed information of effector


Summary

Effector ID EFF01318 experimental
Effector type Tde
Cognate immunity protein IMU00333 experimental
Related T6SS (Type) T6SS00003 experimental (Type i3)
Strain Pseudomonas aeruginosa PAO1
Replicon chromosome
Sequence Protein sequence (387 a.a.); Nucleotide sequence (1161 bp)
Description Tse7 encodes an N-terminal DUF4150 PAAR-like domain and a C-terminal Tox-GHH2 domain. Tse7, is a DNase whose activity is blocked through direct interaction with its cognate immunity Tsi7 protecting the producing cell. The
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA0099 (Tse7)
Coordinates (Strand) 120164..121324 (+)
NCBI ID 15595297
RefSeq NC_002516
Uniprot ID TSE7_PSEAE
KEGG ID pae:PA0099
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Tox-GHH2 PF15635.8 1.6e-53 226..343
DUF4150 PF13665.8 6.7e-36 21..134

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-386 MANEVYANNMEISCKAANGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWPYLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTARRCALQPYKPNSCCPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMHTFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINARTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9460 - -



  Protein sequence: 387 a.a.    .

>EFF01318 NC_002516:120164-121324 [Pseudomonas aeruginosa PAO1]
MANEVYANNMEISCKAANGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTS
YGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWPYLDQATVDAGGGPCSNEVKK
EKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTARRCALQPYKPNSCCPQQTAHHLIEASALHDK
GRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMHTFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAA
MGKVFPQSKCSKECLSAQLDNYHKQCGINARTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR*

  Nucleotide sequence: 1161 bp    .

>EFF01318 NC_002516:120164-121324 [Pseudomonas aeruginosa PAO1]
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAACGGCAAGTCCATCGCGGCCTTCCCGGA
TGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCCCAATACCGGCCTGTCCAAGG
ACACCACCAAAGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATGCTGAAGAACAAGAGCTACTACAAGACCAGC
TACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCGTCACCAGCAAGATCAAGGGCAAGGTGTACTTCACCTCCTG
GTCGATGAACGTCAAGTTCGAAAGCAAGAACGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCTG
GCAATACGCCGGTCTGGCCCTACCTCGACCAGGCCACCGTCGATGCTGGTGGTGGACCGTGCAGCAATGAAGTGAAGAAG
GAGAAGAAGGATTGCGCTGACTTCAAGCCGCATGGCAGCAAGGATGCCTGCGCTGGCCTTGGCGCGGGCAAGCCTTCCGG
CAAGAAGACCAGCAACGAAGCTGACCGACTGGCAGACAAGGTCGCTGCCCGAAAATGCCTGACCGCGCGCCGGTGTGCCC
TGCAACCGTACAAGCCGAACAGTTGCTGCCCGCAGCAGACCGCTCACCACCTGATCGAGGCCAGCGCCTTGCACGACAAG
GGACGTGGTGGAAAAGGCTCGGTACCCCTCAAGGGGATATCCAACTATTCGGAGAACAAGGCTCCTTGCGTCTGCGCGGA
GGGCGTCAATCAGAACGTGGGTACCCACGGCCTCATGCACACGTTCCAGAGCGCCGCTGCCGCGAAGTCGCGCAGTGGAA
CCCTGCAATTGTCCAATGGCAGCTCCATCTCCGCGAAGAAGACCACCTACGGAACGGCGAAACGTCAATCCATGGCTGCC
ATGGGCAAGGTCTTTCCGCAGTCGAAATGCTCGAAGGAATGTCTGTCCGCTCAGCTCGACAACTATCACAAGCAGTGCGG
AATCAACGCCAGAACACCCATCAAGGCCGTTGAAACCGGCCAGACCGACGTCACGGCTGCGACGCAGGCGATAAAGACCC
GCAATGCGCGTCTTGGCGCCACGAGGAGTCGAGTCCGCTAG