Detailed information of effector


Summary

Effector ID EFF01311 experimental
Effector type Tse
Cognate immunity protein IMU00057 experimental
Related T6SS (Type) T6SS00910 experimental (Type iii)
Strain Flavobacterium johnsoniae UW101
Replicon chromosome
Sequence Protein sequence (551 a.a.); Nucleotide sequence (1653 bp)
Description Fte1 induced significant cell lysis of Escherichia coli
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Fjoh_3257 (Fte1)
Coordinates (Strand) 3895944..3897596 (-)
NCBI ID 146301001
RefSeq NC_009441
Uniprot ID UPI00006E8CB2
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-550 MSRIRLVRGTITKTTGGDHNIYSEGNIVYNSGQAVTETSDTGIKYGDPKDIPQRKNDDFDITFELDKKTKSVVPLGILDFKNNAENPYFCFKFGLKKTSIDSLNFQIIGENDEIIYQMTYLQTIIVKASELPKIFSNIPKSTQEPILSKIWDFQKIYNEFASSPGDYTKEGEYVIHWDGFDNNDVYDSTKFNNKKLKARITATKGDKQKSLTIDFSTNYTQVQWTDVKIDRSKKRIDITLRVDLRDGGTKGLNCYTYNLPEESSYETFTPTTGTDPLKGYKTTICDWDKIPASELNPAQPVLKTRTKSFEELKKLAFEGLERYWGRNKNNIVGNNVNIIDSYEVFIKPIDTTKNALNSLPLVYNTNGGWMRSGNPGASYDDGNLDDDLLNALPDLGVIQRLSYNAGYIKHDWKNDAHNGWRYHIEKDSNTYYDEVSNFKETAAHELGHEFLQAYAGTAFSWQHKGSSYYLPQDTKPIKGDETFWGKMTHMDEMPETSGEYYPKNGEIDLMKYYNTTDKAGKFVAGADLKRTIAAEKDVLGLIWLTKLKIQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9608 - -



  Protein sequence: 551 a.a.    .

>EFF01311 NC_009441:c3897596-3895944 [Flavobacterium johnsoniae UW101]
MSRIRLVRGTITKTTGGDHNIYSEGNIVYNSGQAVTETSDTGIKYGDPKDIPQRKNDDFDITFELDKKTKSVVPLGILDF
KNNAENPYFCFKFGLKKTSIDSLNFQIIGENDEIIYQMTYLQTIIVKASELPKIFSNIPKSTQEPILSKIWDFQKIYNEF
ASSPGDYTKEGEYVIHWDGFDNNDVYDSTKFNNKKLKARITATKGDKQKSLTIDFSTNYTQVQWTDVKIDRSKKRIDITL
RVDLRDGGTKGLNCYTYNLPEESSYETFTPTTGTDPLKGYKTTICDWDKIPASELNPAQPVLKTRTKSFEELKKLAFEGL
ERYWGRNKNNIVGNNVNIIDSYEVFIKPIDTTKNALNSLPLVYNTNGGWMRSGNPGASYDDGNLDDDLLNALPDLGVIQR
LSYNAGYIKHDWKNDAHNGWRYHIEKDSNTYYDEVSNFKETAAHELGHEFLQAYAGTAFSWQHKGSSYYLPQDTKPIKGD
ETFWGKMTHMDEMPETSGEYYPKNGEIDLMKYYNTTDKAGKFVAGADLKRTIAAEKDVLGLIWLTKLKIQ*

  Nucleotide sequence: 1653 bp    .

>EFF01311 NC_009441:c3897596-3895944 [Flavobacterium johnsoniae UW101]
ATGAGCAGAATAAGATTAGTTAGAGGTACTATAACAAAAACTACCGGAGGTGATCACAATATTTATTCTGAAGGTAATAT
TGTATATAATTCTGGTCAGGCTGTAACCGAGACGAGTGACACAGGAATTAAGTACGGAGATCCGAAAGATATCCCTCAAA
GAAAAAATGATGATTTTGATATTACATTTGAATTAGATAAAAAAACAAAGTCAGTTGTTCCTTTGGGTATTTTAGATTTT
AAGAATAATGCAGAAAATCCTTATTTCTGCTTTAAATTTGGTTTAAAGAAGACATCAATTGATTCTTTAAATTTTCAAAT
AATAGGTGAAAATGATGAAATTATTTATCAAATGACCTACTTACAAACGATTATAGTAAAAGCTTCTGAACTTCCTAAAA
TCTTTTCAAATATACCCAAATCAACACAAGAACCAATTTTATCTAAAATTTGGGATTTTCAAAAAATTTATAATGAATTT
GCATCTTCACCAGGTGATTACACTAAAGAAGGTGAATATGTTATTCATTGGGATGGTTTTGATAATAATGATGTTTATGA
CAGCACCAAATTCAATAATAAGAAGTTAAAGGCTAGAATTACGGCTACCAAAGGTGATAAGCAAAAAAGTTTGACAATAG
ATTTTTCTACTAATTATACTCAAGTACAATGGACTGACGTAAAAATTGATAGAAGCAAGAAACGAATTGATATAACCTTA
AGAGTAGATTTAAGGGATGGTGGTACAAAAGGTTTGAATTGTTATACTTATAATTTACCTGAGGAGTCAAGTTATGAAAC
GTTTACCCCGACTACAGGAACTGATCCTCTTAAAGGGTATAAAACAACTATTTGCGATTGGGATAAAATACCGGCTTCGG
AATTAAATCCTGCACAACCGGTTTTAAAGACTAGAACAAAATCTTTTGAAGAATTAAAAAAACTTGCTTTTGAAGGTCTG
GAAAGATATTGGGGAAGAAATAAAAATAATATTGTTGGTAATAATGTAAATATTATTGATTCTTATGAAGTATTTATAAA
ACCAATTGATACTACTAAAAATGCTCTAAATTCTCTACCGTTGGTGTATAATACTAATGGAGGATGGATGCGGTCAGGTA
ATCCTGGAGCAAGCTATGATGATGGTAATTTAGATGATGATTTGTTAAATGCTCTTCCAGATTTAGGTGTAATACAAAGA
TTATCTTATAATGCAGGATATATTAAACATGATTGGAAAAATGATGCTCACAACGGATGGCGCTATCATATTGAAAAAGA
TTCAAATACGTATTATGATGAAGTTTCAAATTTTAAAGAAACAGCTGCTCATGAATTAGGACATGAATTTTTACAAGCCT
ATGCAGGAACAGCATTCTCATGGCAGCACAAAGGAAGTTCATATTATTTACCTCAAGATACTAAGCCTATAAAGGGAGAT
GAAACCTTTTGGGGTAAAATGACTCATATGGATGAAATGCCTGAAACTTCAGGAGAATATTATCCTAAGAATGGTGAAAT
AGACCTAATGAAATATTATAATACTACTGATAAAGCAGGGAAATTTGTTGCAGGGGCTGATTTAAAAAGAACAATTGCTG
CAGAAAAGGACGTATTAGGTCTGATATGGTTAACAAAACTTAAAATACAATGA