Detailed information of effector


Summary

Effector ID EFF01307 experimental
Effector type Tde
Cognate immunity protein IMU00054 experimental
Related T6SS (Type) T6SS00016 experimental (Type i5)
Strain Agrobacterium fabrum str. C58
Replicon chromosome
Sequence Protein sequence (527 a.a.); Nucleotide sequence (1581 bp)
Description Tde2; DNase Effector
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) Atu3640 (Tde2)
Coordinates (Strand) 692241..693821 (-)
NCBI ID 15891300
RefSeq NC_003063
Uniprot ID A9CFH2_AGRFC
KEGG ID atu:Atu3640
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Ntox15 PF15604.8 4e-58 352..512
DUF4150 PF13665.8 4.6e-33 35..141

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-526 MSIPRDNYIGEPQYPDTWTTKTPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAMVMRSCTTHVHGDAPGVRKGVKSGTVESVCEPIGHADQVRAEGSHVIRHLDRFHMNSKNTEGEAIFVRSTQTYNSPKDDDPVRGSLRAIEVADASEEQNRSSDAAPSGGAALGFLVTPGFAPLVQGAGGAAAGGASTAAGAATSGAGGAAAAAGGVSLGTILAGIGIFAAGVLIPTNKMNFSDTVPQDDFEQKLLLDAQRRMNELPFWDSGADIRTETFAKIQEHRKKNKPTQDPEPTPVPVPPPGSNVRIDEDENRRCRLLIICFMPTKSTIDIDEFKRQMELQEQGLNNMSPQQMLANQAKYLANPAGMRALSEPLQAKARQEYRNDPRIQKKYVDQYGPIQGPIKLGEYLDSAAALHNPDMIAGGKYNSVVDQTLPIENRIGGLSENSSMGSQWINPNRNGHTRASRLTEHAKRQAANNCPSVQVDLRLCPSNPSRPGEPLTGT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9814 - -



  Protein sequence: 527 a.a.    .

>EFF01307 NC_003063:c693821-692241 [Agrobacterium fabrum str. C58]
MSIPRDNYIGEPQYPDTWTTKTPREGLRDIDEARIVSLAPDVCLTPVGSSVVPIPYPVVDFCGHDKNYTPSVRFTGKKAM
VMRSCTTHVHGDAPGVRKGVKSGTVESVCEPIGHADQVRAEGSHVIRHLDRFHMNSKNTEGEAIFVRSTQTYNSPKDDDP
VRGSLRAIEVADASEEQNRSSDAAPSGGAALGFLVTPGFAPLVQGAGGAAAGGASTAAGAATSGAGGAAAAAGGVSLGTI
LAGIGIFAAGVLIPTNKMNFSDTVPQDDFEQKLLLDAQRRMNELPFWDSGADIRTETFAKIQEHRKKNKPTQDPEPTPVP
VPPPGSNVRIDEDENRRCRLLIICFMPTKSTIDIDEFKRQMELQEQGLNNMSPQQMLANQAKYLANPAGMRALSEPLQAK
ARQEYRNDPRIQKKYVDQYGPIQGPIKLGEYLDSAAALHNPDMIAGGKYNSVVDQTLPIENRIGGLSENSSMGSQWINPN
RNGHTRASRLTEHAKRQAANNCPSVQVDLRLCPSNPSRPGEPLTGT*

  Nucleotide sequence: 1581 bp    .

>EFF01307 NC_003063:c693821-692241 [Agrobacterium fabrum str. C58]
ATGAGTATCCCTCGCGACAACTATATCGGTGAACCACAATACCCCGATACATGGACGACGAAGACGCCACGCGAGGGGTT
ACGTGACATTGATGAGGCGCGTATCGTCTCTTTGGCACCTGATGTATGCCTGACACCGGTCGGCTCGTCGGTGGTGCCTA
TTCCCTATCCTGTCGTGGATTTTTGTGGCCACGATAAAAATTACACGCCTTCCGTTCGGTTTACGGGTAAGAAGGCGATG
GTCATGCGTTCGTGCACAACACATGTCCATGGCGATGCACCCGGTGTCCGAAAAGGTGTGAAATCTGGAACGGTGGAGAG
CGTATGCGAACCGATCGGCCATGCCGACCAGGTGCGTGCAGAGGGTTCGCACGTCATCCGCCACCTCGACCGTTTTCATA
TGAACAGCAAGAATACCGAGGGTGAGGCGATCTTTGTCCGCAGCACGCAGACATATAACTCTCCCAAGGACGATGATCCG
GTGCGAGGATCGCTTCGTGCAATTGAAGTCGCCGATGCTTCAGAAGAGCAAAACCGTTCATCTGACGCTGCTCCTTCCGG
TGGCGCTGCTCTAGGTTTTCTCGTCACGCCAGGATTTGCTCCACTCGTTCAAGGTGCGGGTGGAGCCGCGGCTGGAGGAG
CAAGTACCGCTGCCGGTGCAGCAACTTCCGGTGCTGGAGGGGCTGCCGCCGCCGCGGGAGGTGTCAGTTTGGGAACGATA
TTGGCGGGGATCGGAATATTCGCCGCCGGTGTGCTTATTCCGACCAACAAAATGAATTTTTCCGATACCGTCCCACAGGA
TGATTTTGAACAGAAATTGCTTTTAGATGCGCAACGCAGAATGAACGAACTTCCATTCTGGGACAGTGGTGCTGACATCC
GAACTGAGACGTTTGCAAAAATTCAGGAGCACAGAAAGAAAAATAAACCTACGCAGGACCCGGAGCCTACGCCTGTCCCT
GTGCCGCCACCTGGATCAAATGTTCGTATAGACGAAGATGAGAACCGTAGATGTCGGTTATTGATAATATGCTTTATGCC
CACCAAAAGTACGATCGATATTGATGAGTTCAAGCGACAAATGGAATTGCAGGAACAAGGGCTCAACAATATGAGTCCAC
AGCAGATGCTGGCCAATCAAGCAAAATATCTAGCAAATCCGGCGGGCATGCGGGCTTTGTCGGAGCCACTGCAGGCGAAA
GCGCGCCAAGAATATAGAAACGACCCGCGTATCCAGAAAAAGTACGTTGATCAGTACGGTCCAATCCAGGGTCCGATAAA
ATTGGGAGAATATCTGGATTCGGCGGCGGCATTGCATAATCCAGACATGATCGCGGGTGGGAAATATAATTCTGTGGTCG
ATCAGACCTTGCCAATTGAAAATCGGATAGGTGGCCTTTCCGAGAATAGTTCTATGGGAAGTCAATGGATCAATCCAAAT
CGAAACGGACATACTCGCGCCAGCCGACTAACAGAGCATGCTAAGAGACAAGCGGCGAACAACTGCCCCAGTGTGCAAGT
CGATCTTCGACTTTGCCCCAGCAACCCCAGTCGCCCCGGTGAGCCATTAACAGGAACATGA