Detailed information of effector


Summary

Effector ID EFF01294 experimental
Effector type Tde
Cognate immunity protein IMU00052 experimental
Related T6SS (Type) T6SS00043 experimental (Type i1)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome
Sequence Protein sequence (719 a.a.); Nucleotide sequence (2157 bp)
Description V. parahaemolyticus T6SS1 effector VP1415 have an N-terminal PAAR domain and a AHH nuclease domain
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VP_RS06875
Coordinates (Strand) 1522167..1524323 (+)
NCBI ID 28898189
RefSeq NC_004603
Uniprot ID Q87PT6_VIBPA
KEGG ID vpa:VP1415
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4150 PF13665.8 7.4e-35 22..127
AHH PF14412.8 1.2e-20 529..652

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-718 MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPIVPIPYGNNAKSADLAGGTTTISMDGGNSVAIKGSTFSKSTGDAGGDKKGVASGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKANTMCLGGAQNPSVSVTEADDGTFTIDIDYRYPDGDPVYKADFKIIDSTGTEHVGTLSDKGKGTITGLPAGSISLFLGEDKRDIEPIQKPQPNKDYLELPGPLDLVEFAGRGLVEYWDAVEMPSDYSQWAWGAIMGDFNQDRSAGQIAFDSAVTAIPFIDQIGDGRDISANLYAFYNADDIREDKEKYTDLVITLVGFIPTAGSLIKGLFKELKILGKAADLDMIAAFLRAGAKGDVVKWMQSLDMSVIKNDIYGQLDDITKQVKTLMDTLEQESRKRGYTVVADAYKRCVEQLDDFFKKADGPISKVLSDFDDRLKMILPEAPLVTSGTSFSISAGTAQGGGKAEVIKTRNKTKKKTDTCPLCNKKIGKGKKECEGAKVGSISKAVMDDGSSQKLWKEFEIRNGWRDKTEHPWWHGAGAVQAHHLIPKNAFKLKNAKSKQTKEKMMFLRRIAQTCAYNIDFWKNGIGLPNKKETACFLRKPRHAGGHDRNEFNYTNECVKLVHDKLSSDIKKRTKEGSCSKTTNSSLIMKFNESSKNIFDNIADFIWFITRDGKNYDPKVEPYVGCSSNCKKIHPIININTKRQIENYDLEIGK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7834 - -



  Protein sequence: 719 a.a.    .

>EFF01294 NC_004603:1522167-1524323 [Vibrio parahaemolyticus RIMD 2210633]
MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPIVPIPYGNNAKSADLAGGTTTISMDGGNSVAIKGSTFSKSTGDA
GGDKKGVASGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKANTMCLGGAQNPSVSVTEADDGTFTIDIDYRYPDGDP
VYKADFKIIDSTGTEHVGTLSDKGKGTITGLPAGSISLFLGEDKRDIEPIQKPQPNKDYLELPGPLDLVEFAGRGLVEYW
DAVEMPSDYSQWAWGAIMGDFNQDRSAGQIAFDSAVTAIPFIDQIGDGRDISANLYAFYNADDIREDKEKYTDLVITLVG
FIPTAGSLIKGLFKELKILGKAADLDMIAAFLRAGAKGDVVKWMQSLDMSVIKNDIYGQLDDITKQVKTLMDTLEQESRK
RGYTVVADAYKRCVEQLDDFFKKADGPISKVLSDFDDRLKMILPEAPLVTSGTSFSISAGTAQGGGKAEVIKTRNKTKKK
TDTCPLCNKKIGKGKKECEGAKVGSISKAVMDDGSSQKLWKEFEIRNGWRDKTEHPWWHGAGAVQAHHLIPKNAFKLKNA
KSKQTKEKMMFLRRIAQTCAYNIDFWKNGIGLPNKKETACFLRKPRHAGGHDRNEFNYTNECVKLVHDKLSSDIKKRTKE
GSCSKTTNSSLIMKFNESSKNIFDNIADFIWFITRDGKNYDPKVEPYVGCSSNCKKIHPIININTKRQIENYDLEIGK*

  Nucleotide sequence: 2157 bp    .

>EFF01294 NC_004603:1522167-1524323 [Vibrio parahaemolyticus RIMD 2210633]
ATGGGCGTAACAGTTGGTGCAAATGGACTTTCGATAGTTCATAAAGGCTCAGGTGGTGAAGCGAATGCAACGCTCCCAGA
TGTTTGTTTAACGAAGGTCGGTAAGCCGATCGTTCCTATCCCTTATGGCAACAATGCCAAATCAGCAGATCTTGCTGGTG
GCACTACGACTATCTCTATGGATGGTGGCAACAGTGTCGCAATTAAAGGCAGTACGTTTTCAAAAAGTACCGGTGATGCG
GGCGGCGATAAAAAAGGCGTCGCATCCGGCACGATAGAAGCCGAAGCAAAATTCATTTCAGCCTCACCAACGGTTAAGTT
TGAAGGCAAGGGCGTATGTCGCCTGTCTGATCAAATGACCATGAACAAAGCCAACACTATGTGTTTGGGCGGCGCACAAA
ACCCATCGGTTTCTGTTACGGAAGCAGATGATGGAACATTTACCATAGACATTGATTATCGATACCCAGATGGAGACCCA
GTATACAAAGCCGATTTCAAGATTATTGACAGTACTGGTACAGAACATGTTGGCACTTTAAGCGACAAAGGTAAGGGGAC
GATTACGGGCTTACCAGCAGGTTCTATCAGTTTATTCCTGGGTGAGGATAAGAGAGATATAGAGCCAATCCAAAAGCCGC
AACCAAACAAGGATTATCTTGAACTGCCGGGGCCTTTGGACTTAGTAGAGTTTGCTGGACGTGGCTTGGTTGAATATTGG
GATGCTGTTGAAATGCCGAGTGATTATAGTCAATGGGCTTGGGGAGCGATCATGGGGGACTTCAATCAAGATCGATCTGC
TGGCCAAATTGCTTTTGATAGTGCTGTTACAGCTATACCATTCATCGATCAAATTGGGGACGGTCGAGACATTAGTGCCA
ACCTTTATGCTTTTTATAATGCAGACGACATAAGAGAAGATAAAGAAAAGTACACAGATCTCGTTATCACTCTAGTTGGC
TTTATTCCCACCGCAGGTAGCTTGATAAAAGGGTTATTTAAGGAACTTAAAATCTTGGGCAAAGCCGCTGATTTAGATAT
GATTGCTGCTTTCCTTAGAGCCGGAGCAAAAGGTGATGTGGTCAAATGGATGCAAAGCCTTGATATGTCCGTCATCAAAA
ATGATATATATGGTCAACTAGATGATATTACTAAACAAGTAAAAACGTTAATGGATACACTTGAGCAAGAGAGCCGTAAA
AGAGGGTATACTGTTGTTGCTGACGCCTATAAAAGGTGTGTGGAACAGCTAGATGACTTTTTTAAGAAAGCTGACGGACC
AATATCTAAAGTCTTAAGCGATTTTGATGATAGGCTCAAGATGATCCTGCCTGAGGCACCTTTAGTTACATCAGGGACTT
CCTTTAGTATTTCTGCAGGGACGGCTCAAGGAGGAGGCAAAGCTGAGGTAATTAAGACTCGTAATAAGACGAAAAAGAAG
ACTGATACGTGTCCGTTGTGTAATAAAAAGATTGGAAAAGGGAAGAAAGAGTGCGAAGGGGCGAAAGTCGGTAGTATCAG
CAAAGCAGTTATGGACGATGGTTCCTCTCAAAAATTATGGAAAGAATTCGAAATACGAAATGGTTGGCGAGACAAGACAG
AGCACCCTTGGTGGCACGGGGCGGGAGCAGTGCAGGCTCACCATCTTATTCCTAAAAATGCATTCAAACTAAAAAATGCA
AAGAGTAAGCAAACTAAAGAAAAAATGATGTTTCTTAGACGAATTGCTCAGACGTGCGCTTACAACATCGACTTTTGGAA
AAATGGTATTGGCCTTCCTAATAAGAAAGAAACAGCGTGTTTTTTGAGGAAACCTCGACATGCAGGCGGTCACGATCGTA
ATGAATTTAACTACACGAACGAATGTGTAAAGCTTGTTCATGACAAGTTAAGCTCAGATATCAAGAAAAGAACAAAAGAA
GGTAGTTGTTCCAAGACAACAAACTCTTCGTTGATTATGAAGTTCAATGAATCAAGCAAAAATATTTTTGATAATATTGC
TGACTTTATCTGGTTTATTACTCGTGATGGAAAAAACTATGATCCTAAAGTAGAACCTTACGTGGGCTGTAGTTCAAATT
GCAAAAAAATACACCCGATTATTAATATAAACACTAAGCGACAAATTGAAAACTATGACTTAGAGATTGGAAAATAA