Detailed information of effector


Summary

Effector ID EFF01293 experimental
Effector type Tse
Cognate immunity protein IMU00051 experimental
Related T6SS (Type) T6SS00043 experimental (Type i1)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome
Sequence Protein sequence (584 a.a.); Nucleotide sequence (1752 bp)
Description -
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) VP_RS06745
Coordinates (Strand) 1483454..1485205 (+)
NCBI ID 28898162
RefSeq NC_004603
Uniprot ID Q87PW2_VIBPA
KEGG ID vpa:VP1388
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-583 MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSEDILRNLPKELAQKISISAKKSSSGLLTAIRHELGNGNWVALSSFSRRTPLTDTQLQSFPRLKAQLESVSSTGESKVYKAGYKQVKDDVTLVRSYTHVPSEPSPDQKIVVEFAGQWSSNAACLMLGKTEAQKEKVTVGKADTENKHRSLATFKDLEAEGKTLYIKIPCSDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVVPLHFPGSDKSDEAAEVFKSGYVYVVWNNKIWREVAITENGYFSDTDINSVREGSRPKRHADIYMTNPETGGVFAYEPFQIVQNGKVVSEGSLNGSGEARVFNLVEEEVEIVMTGYEPQIKEKIETNLSPINASSPVGRSAQGYPLPHIWLPYKIKGEPQEVYLAYNSKRLSESELSELESDPGTKAIKVTDLNHYSSEKSFKMGDGSVRLLSVLPSAATSKPEKYAMLRSQINKNVAVVYLLKSVEIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCIKKENGSRLIRFTGWPAEVKEVDLLRGYQGNSHHGRDNKTVIFAQTPIADLLAYKKKDQPS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9918 - -



  Protein sequence: 584 a.a.    .

>EFF01293 NC_004603:1483454-1485205 [Vibrio parahaemolyticus RIMD 2210633]
MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSEDILRNLPKELAQKISISAKKSSSGLLTAIRHELGNGNWVALS
SFSRRTPLTDTQLQSFPRLKAQLESVSSTGESKVYKAGYKQVKDDVTLVRSYTHVPSEPSPDQKIVVEFAGQWSSNAACL
MLGKTEAQKEKVTVGKADTENKHRSLATFKDLEAEGKTLYIKIPCSDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVV
PLHFPGSDKSDEAAEVFKSGYVYVVWNNKIWREVAITENGYFSDTDINSVREGSRPKRHADIYMTNPETGGVFAYEPFQI
VQNGKVVSEGSLNGSGEARVFNLVEEEVEIVMTGYEPQIKEKIETNLSPINASSPVGRSAQGYPLPHIWLPYKIKGEPQE
VYLAYNSKRLSESELSELESDPGTKAIKVTDLNHYSSEKSFKMGDGSVRLLSVLPSAATSKPEKYAMLRSQINKNVAVVY
LLKSVEIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCIKKENGSRLIRFTGWPAEVKEVDLLRGYQGNSHHGRDN
KTVIFAQTPIADLLAYKKKDQPS*

  Nucleotide sequence: 1752 bp    .

>EFF01293 NC_004603:1483454-1485205 [Vibrio parahaemolyticus RIMD 2210633]
ATGCATTTAGTTTGCAAATTTATACCTAGCTCGAAGCTTTCCTCCAACGAGCTATCCTACGTCCTTACACCTGATGAGTG
TATAGGGCAGCTTTCGCGTGTGCGAAATTCAGAAGACATTCTCAGAAACCTTCCTAAAGAGCTTGCTCAGAAGATCTCAA
TCTCTGCCAAGAAGTCTAGCTCCGGGTTGCTAACGGCTATTCGACACGAGCTAGGAAATGGGAACTGGGTTGCGTTGTCT
TCTTTCTCTCGTAGAACGCCGTTAACAGATACCCAATTACAAAGTTTCCCAAGACTAAAAGCACAGCTTGAATCGGTCTC
ATCGACTGGTGAGAGCAAAGTTTATAAAGCGGGTTATAAGCAGGTAAAGGACGACGTGACTTTGGTTCGTAGCTACACGC
ATGTCCCTTCTGAGCCAAGTCCAGACCAAAAAATCGTTGTCGAGTTTGCAGGGCAGTGGTCTAGCAACGCGGCATGTTTG
ATGTTGGGAAAAACCGAAGCTCAAAAAGAAAAAGTTACTGTAGGCAAGGCTGATACAGAAAACAAACACCGCAGCCTCGC
GACATTTAAAGATCTCGAAGCTGAGGGCAAAACGCTCTATATCAAAATCCCTTGTTCCGACCAGCCTCAGCCAATCTTGC
TTAAACTCGCCGAAGACCTGCAACCCGTTGATAAAGAAACTCAAATGGATGAGTGGGATAACGTGTTGGTGCCTGTGGTT
CCGCTGCACTTCCCTGGTAGCGATAAATCAGATGAAGCTGCAGAAGTGTTTAAGTCAGGCTACGTGTATGTTGTTTGGAA
CAATAAAATTTGGCGCGAAGTGGCAATTACGGAAAATGGTTACTTTTCAGATACGGACATTAATAGTGTTCGTGAAGGCT
CTAGACCCAAAAGGCACGCCGATATCTATATGACCAATCCTGAAACAGGCGGTGTTTTCGCTTATGAGCCTTTCCAAATC
GTGCAGAACGGCAAGGTGGTAAGTGAAGGCTCTTTGAATGGCTCTGGAGAGGCTCGAGTGTTCAACTTAGTTGAGGAAGA
AGTTGAGATAGTCATGACCGGCTATGAGCCACAAATCAAAGAAAAGATTGAAACAAATTTGAGCCCTATTAATGCTTCTA
GCCCAGTGGGGCGGAGCGCGCAAGGTTACCCTCTCCCGCATATATGGCTTCCTTACAAGATTAAAGGTGAGCCTCAAGAA
GTATATTTGGCTTATAACAGTAAACGATTGAGCGAGAGTGAACTATCTGAACTAGAAAGTGATCCCGGAACCAAGGCCAT
AAAAGTCACTGATCTTAACCATTACAGCAGTGAGAAAAGCTTTAAAATGGGAGACGGTTCTGTTCGTCTGCTCTCAGTAT
TACCAAGTGCTGCGACCTCAAAACCTGAAAAATACGCAATGTTACGAAGCCAGATAAATAAAAATGTAGCGGTCGTGTAT
TTACTTAAATCTGTCGAGATAGTTTTCGAATATCCGGGCTATACGACGCTGGACGAGTCAGATGATTACTTTGAGTTAAG
GCAAAGCGATGGTGATTGGTCGCAGCGAGTGTGCTTGCGCCAATGTATAAAAAAAGAGAATGGTTCTAGGTTGATTCGTT
TTACTGGTTGGCCTGCAGAGGTTAAAGAAGTGGATCTTCTCCGTGGTTATCAGGGCAATAGTCATCACGGAAGAGATAAT
AAAACGGTCATTTTTGCTCAAACACCCATTGCGGATTTACTGGCTTATAAGAAAAAAGATCAGCCAAGTTAA