Detailed information of effector


Summary

Effector ID EFF01255 experimental
Effector type Tse
Cognate immunity protein IMU00056 experimental
Related T6SS (Type) T6SS00395 experimental (Type i3)
Strain Enterobacter cloacae subsp. cloacae ATCC 13047
Replicon chromosome
Sequence Protein sequence (1419 a.a.); Nucleotide sequence (4257 bp)
Description rhsB
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECL_03140 (RhsB)
Coordinates (Strand) 3200343..3204599 (-)
NCBI ID 296103479
RefSeq NC_014121
Uniprot ID A0A0H3CQ96_ENTCC
KEGG ID enc:ECL_03140
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 5.4e-17 241..315
PAAR_motif PF05488.15 9.7e-17 88..153
RHS PF03527.16 8.3e-13 1162..1198
RHS_repeat PF05593.16 4e-07 592..630
RHS_repeat PF05593.16 9.1e-07 741..775
RHS_repeat PF05593.16 3e-05 1071..1113
Tox-GHH PF15636.8 3e-05 1294..1331
RHS_repeat PF05593.16 4.7e-05 639..665

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-14 MFEAARVGDDIGHS
Transmembrane helix 15-37 GALAGMIAGTIVGGLIAAAGGIL
Inside 38-41 AGAM
Transmembrane helix 42-64 FIAGLGASCLGVGVLLVGASLAV
Outside 65-1418 GYYTGELATAARDSIADAGASSMTKKGVITSGSPNVFINSKPAAIATDSAVKCSDDGSQQMAEGSKRVSINSQPASRIGDRTTCDAKVMTGSDNVFIGGDPQQTLPIQSEVPEWLYKVSDLTLLFAGLLGGWGGAAGKVGALSKLLGKIPGINKLARIACRAGTLMTGVAAAGIIARPVDIVSGQKFLSGDDELDFVLPSRLPVRWQRYWRSGNPGDSVLGRGWSLFWESRLEPYQDGLVWRAPSGDYVAFPNVPKGMRTYCESEKNWLEHHHDDSWSVYDVSGERWHYAALKDDAPSLLQRISEPCGNDILFEWNADNTLHALTDSAGQRVVCRYDRDRLASAWLDDEICLVSYAYDEQRQLVCVTGRGGSVRRRFRWQDGLMSAHEDANGLLSEYRWREIDGLPRVVGFRHSGGEQLTFEYDFENGIRRANRDDGAQANWLIDDDDNVARFTDYDGRQTTFVYRDGELSDVILPGGAMRCSTWDKYGRMTSETDPAGRCTEYYWYRLTDRITRTVYPDGTSSQAMYDLRGRLLSETDPAGNATAYHYPDEEENLPESITDALGGVVRLVWNIQGLLTQRTDCSGSVTRFSYDRFGQLIASEDAEGNITRREWNNAGLLSAVIHPDGSRESLVWNERGQLTGWRDPLESEVSWAYNALGLPVSLTDRIGRVRQWRYDPRGNLLRLDNGNGAEYRFTYDAVGRPLSETRPDETVRHMEWDARGFLCALEENGRPAADGGIARRVQQFSYDDSGLLIGRTQRHAEYRYVRDLSGQITRIRRTPTAEGVALGIESDEIAYRHDAAGRVLSESGINGAVGYEWDALSNLTGLTLPGEQKLAWLHYGSGHVSAIRFGQQLVTEFTRDRLHREIRRTQGAREQLRQYDSLGRRTLQRSELSTEVTLPEQAILERLYRYTARGELSGVSDTLRGEVDYGYDAEGRLLKHYEARQGHSRAQFSYDAADNLAANDDAVPVTDNRLQHWQALFMKYDHWGNLVSRRNGLYEQHYAYDAENRLVSARGTGPEGRFEARYHYDALGRRTRKIVTTAHGTTETRFLWQGYRLLQEQQQTGLCSTYIYDPNEAWSPLARVDHLRDQSSGEIYWFNTDLNGAPLEVTDERGAVRWSGQYGSFGEVRHQSEGFSRVVNRTAMAHQPLRYAGQYADGETGLHYNLFRYYDPQVGRFIVQDPIGLNGGWNLYQYAPNPLGWIDPWGLSAQGLVRYKPDPSLSAQPGARATAISRAWGEERELVAAGGGSRDWTAAEREIILSTKNNRQLSSVMSEMGYTGHHINSVKGNGVLGGKWQGDPRNIVFLQNANHPSGYDEHLHGLQGHRGSYDTPGKGRLIDRNLTRKNLKSCQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9388 - -



  Protein sequence: 1419 a.a.    .

>EFF01255 NC_014121:c3204599-3200343 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MFEAARVGDDIGHSGALAGMIAGTIVGGLIAAAGGILAGAMFIAGLGASCLGVGVLLVGASLAVGYYTGELATAARDSIA
DAGASSMTKKGVITSGSPNVFINSKPAAIATDSAVKCSDDGSQQMAEGSKRVSINSQPASRIGDRTTCDAKVMTGSDNVF
IGGDPQQTLPIQSEVPEWLYKVSDLTLLFAGLLGGWGGAAGKVGALSKLLGKIPGINKLARIACRAGTLMTGVAAAGIIA
RPVDIVSGQKFLSGDDELDFVLPSRLPVRWQRYWRSGNPGDSVLGRGWSLFWESRLEPYQDGLVWRAPSGDYVAFPNVPK
GMRTYCESEKNWLEHHHDDSWSVYDVSGERWHYAALKDDAPSLLQRISEPCGNDILFEWNADNTLHALTDSAGQRVVCRY
DRDRLASAWLDDEICLVSYAYDEQRQLVCVTGRGGSVRRRFRWQDGLMSAHEDANGLLSEYRWREIDGLPRVVGFRHSGG
EQLTFEYDFENGIRRANRDDGAQANWLIDDDDNVARFTDYDGRQTTFVYRDGELSDVILPGGAMRCSTWDKYGRMTSETD
PAGRCTEYYWYRLTDRITRTVYPDGTSSQAMYDLRGRLLSETDPAGNATAYHYPDEEENLPESITDALGGVVRLVWNIQG
LLTQRTDCSGSVTRFSYDRFGQLIASEDAEGNITRREWNNAGLLSAVIHPDGSRESLVWNERGQLTGWRDPLESEVSWAY
NALGLPVSLTDRIGRVRQWRYDPRGNLLRLDNGNGAEYRFTYDAVGRPLSETRPDETVRHMEWDARGFLCALEENGRPAA
DGGIARRVQQFSYDDSGLLIGRTQRHAEYRYVRDLSGQITRIRRTPTAEGVALGIESDEIAYRHDAAGRVLSESGINGAV
GYEWDALSNLTGLTLPGEQKLAWLHYGSGHVSAIRFGQQLVTEFTRDRLHREIRRTQGAREQLRQYDSLGRRTLQRSELS
TEVTLPEQAILERLYRYTARGELSGVSDTLRGEVDYGYDAEGRLLKHYEARQGHSRAQFSYDAADNLAANDDAVPVTDNR
LQHWQALFMKYDHWGNLVSRRNGLYEQHYAYDAENRLVSARGTGPEGRFEARYHYDALGRRTRKIVTTAHGTTETRFLWQ
GYRLLQEQQQTGLCSTYIYDPNEAWSPLARVDHLRDQSSGEIYWFNTDLNGAPLEVTDERGAVRWSGQYGSFGEVRHQSE
GFSRVVNRTAMAHQPLRYAGQYADGETGLHYNLFRYYDPQVGRFIVQDPIGLNGGWNLYQYAPNPLGWIDPWGLSAQGLV
RYKPDPSLSAQPGARATAISRAWGEERELVAAGGGSRDWTAAEREIILSTKNNRQLSSVMSEMGYTGHHINSVKGNGVLG
GKWQGDPRNIVFLQNANHPSGYDEHLHGLQGHRGSYDTPGKGRLIDRNLTRKNLKSCQ*

  Nucleotide sequence: 4257 bp    .

>EFF01255 NC_014121:c3204599-3200343 [Enterobacter cloacae subsp. cloacae ATCC 13047]
ATGTTTGAAGCTGCACGCGTTGGTGATGATATCGGCCACTCCGGTGCGCTGGCCGGGATGATTGCCGGAACGATTGTCGG
TGGCCTGATTGCCGCCGCCGGGGGCATTCTGGCGGGGGCGATGTTTATTGCCGGTCTCGGCGCATCCTGCCTTGGCGTGG
GTGTGCTGCTCGTCGGCGCAAGCCTGGCCGTGGGGTATTACACCGGGGAGCTGGCGACCGCCGCCCGGGACAGTATCGCC
GATGCCGGGGCATCCAGTATGACGAAGAAAGGCGTCATCACCTCCGGCTCGCCCAATGTGTTTATCAACAGCAAACCCGC
CGCCATCGCGACGGACAGCGCGGTGAAGTGCTCGGACGATGGCTCGCAGCAGATGGCCGAAGGCTCTAAGCGCGTCTCGA
TTAACAGCCAGCCTGCGTCCCGCATCGGGGATCGCACCACCTGCGACGCGAAGGTGATGACCGGCTCGGACAACGTCTTC
ATCGGCGGCGATCCGCAGCAAACCCTGCCCATTCAGTCTGAAGTGCCCGAGTGGCTCTATAAAGTCTCCGATCTTACCCT
GCTGTTCGCCGGGCTTCTCGGTGGCTGGGGCGGTGCGGCCGGCAAAGTCGGGGCGCTCTCTAAGCTGCTGGGCAAAATCC
CTGGGATCAATAAGCTGGCCCGTATCGCCTGCCGCGCCGGCACGCTGATGACCGGCGTAGCGGCCGCGGGGATCATCGCC
CGTCCGGTGGATATCGTCAGCGGACAGAAGTTTCTCAGCGGGGATGATGAACTCGATTTCGTTCTGCCGTCACGCCTGCC
GGTGCGCTGGCAGCGCTACTGGCGCAGCGGCAACCCCGGTGACAGCGTGCTGGGCCGCGGCTGGAGCCTGTTCTGGGAAA
GCCGCCTGGAGCCCTATCAGGACGGGCTGGTGTGGCGTGCGCCGTCCGGCGATTACGTTGCCTTCCCGAACGTGCCGAAA
GGGATGCGCACCTACTGCGAGAGCGAAAAAAACTGGCTTGAACATCACCATGACGACAGCTGGTCGGTGTATGACGTCAG
TGGCGAGCGCTGGCACTACGCAGCGCTGAAAGATGACGCACCGTCACTGCTTCAGCGCATCTCAGAACCCTGCGGCAACG
ATATCCTCTTCGAGTGGAATGCGGATAATACCCTGCATGCCCTGACCGACAGCGCGGGCCAGCGCGTGGTCTGCCGCTAC
GACCGTGACAGGCTCGCCAGCGCCTGGCTGGATGACGAGATTTGCCTGGTCAGTTACGCTTATGATGAACAGCGCCAGCT
GGTCTGTGTGACCGGCCGGGGCGGTAGCGTGCGCCGACGCTTCCGCTGGCAGGACGGGCTGATGAGCGCCCACGAGGACG
CCAATGGCCTGCTGAGCGAATACCGCTGGCGGGAGATTGATGGTCTGCCGCGCGTGGTCGGTTTCCGCCACAGCGGCGGC
GAACAGCTGACGTTTGAATACGATTTTGAAAACGGCATCCGTCGCGCCAATCGTGATGATGGTGCGCAGGCGAACTGGCT
GATTGACGACGACGACAACGTCGCGCGTTTCACGGATTACGACGGCCGCCAGACGACGTTTGTCTACCGCGACGGCGAGC
TCAGCGATGTCATTCTGCCCGGCGGTGCGATGCGCTGCAGTACCTGGGATAAGTATGGCCGCATGACCAGTGAGACGGAC
CCGGCGGGCCGTTGCACAGAATATTACTGGTATCGTCTGACCGATCGCATCACCCGGACGGTCTACCCGGACGGTACTTC
ATCGCAGGCGATGTACGACCTTCGCGGTCGTCTGCTGTCGGAAACGGATCCGGCCGGTAACGCCACCGCGTATCACTATC
CCGATGAGGAAGAGAACCTGCCGGAGAGCATCACCGATGCCCTCGGCGGCGTGGTACGTCTGGTCTGGAACATCCAGGGG
CTGCTGACGCAGCGCACCGATTGCTCTGGCAGCGTGACCCGTTTCAGTTACGACCGTTTCGGGCAGCTGATTGCCAGCGA
GGATGCGGAAGGGAATATCACGCGTCGGGAGTGGAACAACGCCGGGCTGCTGAGTGCCGTGATCCATCCGGACGGCAGCC
GCGAGTCGCTGGTGTGGAACGAACGCGGCCAGCTCACGGGCTGGCGCGACCCGCTGGAAAGCGAGGTAAGCTGGGCCTAT
AACGCGCTCGGTCTCCCGGTCAGCCTCACCGATCGTATTGGCCGCGTGCGCCAGTGGCGCTACGACCCGCGCGGTAACCT
GCTGCGACTCGATAACGGCAACGGGGCGGAATACCGCTTCACCTATGACGCCGTGGGCCGCCCGCTCAGCGAAACGCGCC
CGGACGAGACCGTGCGCCATATGGAATGGGATGCGCGAGGGTTCCTCTGCGCGCTCGAAGAAAACGGCCGACCTGCCGCC
GACGGCGGCATCGCCCGTCGCGTCCAGCAGTTCAGCTATGACGACAGCGGGCTGCTGATCGGGCGCACTCAGCGCCACGC
GGAGTACCGCTACGTCCGCGACCTGAGCGGCCAGATCACCCGCATCCGCCGCACGCCAACAGCCGAAGGCGTTGCGCTGG
GTATCGAAAGCGATGAGATTGCTTACCGCCACGATGCCGCCGGGCGCGTGCTGAGCGAATCCGGCATTAACGGCGCAGTG
GGCTATGAATGGGATGCCCTGAGCAACCTGACCGGCCTGACGCTGCCCGGCGAGCAAAAGCTGGCCTGGCTGCACTATGG
CTCCGGCCATGTCAGCGCCATCCGCTTCGGGCAGCAGTTGGTGACCGAGTTCACCCGCGACCGCCTGCACAGGGAAATTC
GCCGCACCCAGGGCGCGCGCGAGCAGCTCCGCCAGTATGACAGCCTTGGCAGACGTACCCTGCAGCGCAGTGAGCTGAGT
ACGGAGGTGACCCTGCCGGAGCAGGCGATACTGGAACGCCTGTATCGCTACACCGCACGCGGTGAGCTTTCTGGCGTCAG
CGACACCCTGCGCGGTGAGGTGGATTACGGCTACGACGCCGAAGGGCGTCTGCTGAAGCACTACGAGGCCCGACAGGGGC
ACAGCCGCGCGCAGTTCAGCTATGACGCCGCGGATAACCTCGCCGCCAATGATGATGCGGTACCGGTCACGGATAACCGC
CTGCAGCACTGGCAGGCGCTGTTTATGAAATACGACCACTGGGGCAACCTGGTCAGCCGCCGCAACGGGCTGTATGAACA
GCATTATGCGTATGACGCCGAGAACCGTCTGGTATCCGCCCGCGGAACCGGGCCGGAAGGGCGGTTTGAGGCGCGCTATC
ACTACGACGCGCTGGGCCGCCGTACCCGCAAAATCGTCACCACCGCGCACGGCACCACCGAAACGCGCTTCCTGTGGCAG
GGCTACCGCCTGTTGCAGGAGCAGCAGCAAACCGGGTTGTGCAGTACATATATTTATGACCCGAATGAAGCCTGGAGCCC
GCTGGCGCGGGTGGATCATCTCCGAGACCAGAGCAGCGGTGAGATTTACTGGTTCAACACCGACCTGAACGGCGCGCCGC
TGGAGGTGACCGACGAACGTGGTGCGGTACGCTGGAGCGGCCAGTACGGCAGCTTTGGCGAGGTGCGCCATCAGAGCGAA
GGGTTCTCACGGGTTGTGAATCGCACAGCGATGGCGCATCAACCGCTTCGCTATGCAGGGCAGTACGCTGACGGTGAAAC
GGGGCTGCACTATAACCTGTTCCGCTACTACGACCCGCAGGTCGGGCGGTTTATTGTGCAGGATCCGATTGGGTTGAATG
GCGGGTGGAACCTTTATCAGTATGCGCCGAATCCGTTGGGGTGGATTGATCCGTGGGGACTCTCCGCGCAAGGTTTAGTT
CGTTACAAACCAGATCCTAGCCTTAGCGCGCAGCCGGGAGCTAGGGCGACAGCAATAAGCCGAGCATGGGGAGAAGAAAG
AGAACTAGTTGCGGCTGGAGGTGGAAGCCGAGACTGGACGGCTGCTGAACGGGAAATAATACTAAGCACAAAAAATAACC
GCCAATTATCGTCGGTTATGTCCGAAATGGGTTATACAGGCCATCATATCAATAGTGTGAAAGGTAATGGTGTTCTGGGA
GGAAAATGGCAAGGTGATCCAAGGAATATTGTATTTCTCCAGAATGCTAATCATCCAAGCGGCTATGATGAGCATTTACA
TGGACTACAAGGTCATCGTGGCAGTTATGACACTCCAGGTAAAGGACGACTGATAGACCGCAACCTTACCCGTAAGAATT
TGAAGAGCTGTCAATAA