Detailed information of effector


Summary

Effector ID EFF01254 experimental
Effector type Tse
Cognate immunity protein IMU00055 experimental
Related T6SS (Type) T6SS00395 experimental (Type i3)
Strain Enterobacter cloacae subsp. cloacae ATCC 13047
Replicon chromosome
Sequence Protein sequence (1463 a.a.); Nucleotide sequence (4389 bp)
Description rhsA
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) ECL_01567 (RhsA)
Coordinates (Strand) 1591543..1595931 (+)
NCBI ID 296101929
RefSeq NC_014121
Uniprot ID A0A0H3CIL2_ENTCC
KEGG ID enc:ECL_01567
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 1.1e-21 293..367
RHS PF03527.16 7e-13 1222..1258
RHS_repeat PF05593.16 6.1e-09 697..734
RHS_repeat PF05593.16 2.1e-08 921..957
PAAR_motif PF05488.15 5.1e-08 178..219
RHS_repeat PF05593.16 8.5e-07 591..627
RHS_repeat PF05593.16 3.6e-05 483..512
RHS_repeat PF05593.16 9.3e-05 760..797

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-28 MSDNNAARKGDEIIHSSIFADITSIVAE
Transmembrane helix 29-51 GAAYAVIGAAVGLAATAAAPLLG
Inside 52-57 AGAAAA
Transmembrane helix 58-80 GVAAIGSSCLLSGIVGGVLANLA
Outside 81-1462 GVTDDISNIAEGLGDALFPPSPAGKITTGSSNVLTNSLPAARAAGTLTPADTPPPEPQSPGSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDKVACEKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEGTVSDDVSPNVIIGGETLTVRDIKSGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGMLADMAVNAVFGSSHPVHAATGVKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATTFDSYLTLEENNATWFDETGRELSFELPPVDHAFYSISEGIIIRRNESGDVAIADDDGAVWRLYKPTRVNPSVLRLASLSDEYGNALLTEWDEHGRLVGLHDEPRAIDVSLLYEDERFPQRVTAASHFDGSRSWPLMQWGYDARGQLASATDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWKKFDHWRVVENRTSTGDGCRFTYDLDAGLTTVEHYDGQKRQHYWNAQNLIVRYVDERGENWCYTWDENELLTQRIDPLGNTVTFVYDEMGNRVQEIDPDGNARTTTWLEHRALPTAIIEADGSATRFWYDEHHGLNRVVDPMGQTTLLRRDEFGQVVEEVDAAGNSRHHEYNEAGQVVRATDCSGHTTRYQYHPLGWLMTETGADGEETRYRYDAAGRPVQLDRPEGWTESLKWNKRGLPVKHAGADGKESEFRYDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGPDSLLLEEVGLDGVASQYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLTRIGLHPALSADAWSTEAEQELSFEYDALGRVTREAGEHGELAWQYDALGNRTSVTLPDGRELKQFYYGSGHLLSIALDKLSVSDFTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQRPSPRRWSRRWDYDYRNNLVREERDDNPFSWYRWQYDSAGRLLVQDGTLPGQEQWRWDAAGNPLDGSAEKITHNRLTQLNGIRWRYDIHGRTVEKDNGQTRWHYRYDGEHRLTEVISQPRDRNRPQTQVSFRYDPLGRRISKTRQQMLGGQATGKPITTRFVWEGFRLLQELHGDVPLTYVYSDQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDIEGQVRWEGVNSAWGKLLRESETQLSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYGANSLTRIDPLGLKQEEVIRYMSKDEAIASAAERGGKGGLVPNNRGDKAIWVNHDSRPGFNPGNEKYRAVMTVNDSGVELLNQHSDISKVDYKETGLKDGVLSKRNEPGAKGIGKNILARFNDKITSFQIEKKDAKGNWKKCGKRIT



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.5440 - -



  Protein sequence: 1463 a.a.    .

>EFF01254 NC_014121:1591543-1595931 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGLAATAAAPLLGAGAAAAGVAAIGSSCLLSGIVGGVLANLA
GVTDDISNIAEGLGDALFPPSPAGKITTGSSNVLTNSLPAARAAGTLTPADTPPPEPQSPGSFADYAGMLLSAAGQFGSE
MWQPSVASAAAGTSPLEEDKVACEKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEGTVSDDVSPNVIIGGETLTVRDIK
SGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGMLADMAVNAVFGSSHPVHAATGVKVLNDDDELDFSLPGRFPL
RWQRSYNSLTTREGLFGLGWATTFDSYLTLEENNATWFDETGRELSFELPPVDHAFYSISEGIIIRRNESGDVAIADDDG
AVWRLYKPTRVNPSVLRLASLSDEYGNALLTEWDEHGRLVGLHDEPRAIDVSLLYEDERFPQRVTAASHFDGSRSWPLMQ
WGYDARGQLASATDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWKKFDHWRVVENRTSTGDGCRFTYDLDAGLTTVEH
YDGQKRQHYWNAQNLIVRYVDERGENWCYTWDENELLTQRIDPLGNTVTFVYDEMGNRVQEIDPDGNARTTTWLEHRALP
TAIIEADGSATRFWYDEHHGLNRVVDPMGQTTLLRRDEFGQVVEEVDAAGNSRHHEYNEAGQVVRATDCSGHTTRYQYHP
LGWLMTETGADGEETRYRYDAAGRPVQLDRPEGWTESLKWNKRGLPVKHAGADGKESEFRYDEAGRLTATRNTQGEEVRR
RWDSRGRLIALENENGEAYQFRWGPDSLLLEEVGLDGVASQYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTT
PEGQTRYHYTPSGLLTRIGLHPALSADAWSTEAEQELSFEYDALGRVTREAGEHGELAWQYDALGNRTSVTLPDGRELKQ
FYYGSGHLLSIALDKLSVSDFTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQRPSPRRWSRRWDYDYRNNLV
REERDDNPFSWYRWQYDSAGRLLVQDGTLPGQEQWRWDAAGNPLDGSAEKITHNRLTQLNGIRWRYDIHGRTVEKDNGQT
RWHYRYDGEHRLTEVISQPRDRNRPQTQVSFRYDPLGRRISKTRQQMLGGQATGKPITTRFVWEGFRLLQELHGDVPLTY
VYSDQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDIEGQVRWEGVNSAWGKLLRESETQLSGYSQNLRMQGQYLDRE
TGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYGANSLTRIDPLGLKQEEVIRYMSKDEAIASAAERGGKGGLVPNNR
GDKAIWVNHDSRPGFNPGNEKYRAVMTVNDSGVELLNQHSDISKVDYKETGLKDGVLSKRNEPGAKGIGKNILARFNDKI
TSFQIEKKDAKGNWKKCGKRIT*

  Nucleotide sequence: 4389 bp    .

>EFF01254 NC_014121:1591543-1595931 [Enterobacter cloacae subsp. cloacae ATCC 13047]
ATGAGCGATAACAACGCGGCCCGCAAGGGTGACGAGATTATTCACTCCAGCATTTTCGCGGATATCACCAGCATTGTGGC
GGAAGGTGCCGCCTACGCGGTGATCGGCGCGGCGGTAGGGCTGGCAGCAACTGCCGCCGCACCACTGCTGGGGGCCGGGG
CAGCCGCTGCGGGCGTGGCGGCGATTGGATCCAGCTGCCTGTTAAGCGGGATCGTTGGCGGCGTACTGGCTAACCTGGCG
GGTGTTACTGACGATATCAGTAATATCGCGGAGGGACTGGGTGATGCGCTGTTCCCGCCGTCTCCCGCAGGTAAAATCAC
CACCGGCTCCAGCAACGTGCTCACCAATAGCCTTCCCGCTGCACGCGCGGCCGGAACGCTGACCCCCGCAGATACGCCAC
CCCCAGAGCCACAGTCACCGGGTAGTTTTGCCGATTACGCCGGCATGTTGCTCTCTGCTGCCGGACAGTTCGGCAGCGAA
ATGTGGCAGCCGAGCGTGGCCTCCGCTGCGGCCGGTACATCGCCGCTGGAAGAGGATAAGGTCGCGTGTGAAAAACACTC
CGGACCACAGTATCTGGCGGAAGGCTCTAAAAGCGTCTTTATCAATGGACAACCGGCAGTACGTGCCAAAGATCGCACCA
CCTGCGAAGGCACCGTTTCCGATGACGTTTCCCCGAATGTGATCATCGGCGGCGAGACGCTGACGGTTCGCGATATCAAG
AGCGGCAAAACGCCGGGGCTGGCACTGGGGATGATTGCGCTCTCCCTGCTGCGCGGCCGTCCGGGCAAGATTTTAAAAAA
CATGCCCTGTGCCCTGGCAGCAGCCGGGGGCGGGATGCTGGCCGATATGGCCGTCAATGCCGTATTTGGTTCCTCGCACC
CGGTTCATGCCGCCACCGGCGTGAAGGTGCTGAATGACGATGATGAGCTCGATTTCTCGCTGCCCGGGCGTTTTCCGCTT
CGCTGGCAGCGCAGTTATAACAGCCTGACCACCCGCGAAGGGTTGTTTGGCCTGGGCTGGGCAACAACCTTTGACAGTTA
TCTGACGCTTGAAGAGAACAATGCCACCTGGTTCGACGAAACCGGGCGTGAGCTGAGCTTTGAACTGCCACCCGTCGACC
ACGCATTCTACAGCATCAGCGAGGGTATCATCATCCGCCGCAACGAGAGCGGTGATGTGGCGATAGCCGATGATGACGGC
GCGGTGTGGCGCCTGTATAAACCGACACGCGTGAATCCATCCGTTCTGCGTCTGGCCTCCCTTAGCGACGAATACGGCAA
CGCACTGCTGACGGAGTGGGATGAGCACGGCAGGCTGGTCGGTTTGCACGATGAGCCGCGGGCAATAGACGTCTCCCTGC
TCTATGAGGACGAACGGTTCCCACAGCGCGTAACCGCTGCCAGCCATTTTGACGGCAGCCGTAGCTGGCCGCTGATGCAA
TGGGGTTACGATGCGCGTGGCCAGCTGGCGAGCGCGACGGATGCCTCTGGTGTAGTCACCCGCGAATACCGCTATAACGA
CCATGGCCTGATGGTCTGGCATCGTCTGCCGGGCGGGCTGGAAAGTGAATACCGCTGGAAAAAATTTGACCACTGGCGCG
TGGTTGAAAACCGCACCAGTACCGGGGATGGCTGTCGCTTCACCTACGATCTTGACGCCGGGTTGACCACCGTCGAACAC
TACGACGGTCAGAAACGTCAGCACTACTGGAACGCGCAAAATCTGATCGTCCGCTACGTTGACGAGCGCGGCGAGAACTG
GTGCTACACGTGGGATGAGAACGAGCTCCTCACGCAACGCATTGATCCGCTCGGGAACACCGTCACCTTCGTTTACGACG
AGATGGGCAACCGGGTGCAGGAGATCGACCCTGACGGCAATGCCCGCACCACGACCTGGCTTGAACACCGCGCGCTACCG
ACGGCCATCATTGAAGCCGACGGCAGCGCTACCCGGTTCTGGTACGACGAACATCACGGCCTGAACCGCGTGGTGGACCC
AATGGGGCAGACCACGCTGCTGCGCCGGGATGAGTTTGGTCAGGTCGTTGAAGAGGTGGATGCCGCCGGAAACAGCCGCC
ATCATGAGTACAACGAAGCAGGACAAGTGGTGCGTGCGACAGACTGCTCTGGCCACACCACCCGCTACCAATATCATCCG
CTGGGCTGGTTGATGACCGAGACGGGCGCCGACGGCGAAGAGACGCGTTATCGCTACGACGCTGCCGGGCGCCCGGTACA
GCTCGATCGCCCGGAAGGCTGGACAGAGTCGCTAAAATGGAACAAACGTGGCCTGCCGGTGAAGCATGCTGGCGCCGACG
GGAAAGAAAGCGAGTTCAGATACGATGAGGCCGGACGCTTAACCGCCACGCGTAATACCCAGGGTGAAGAGGTCCGCCGC
CGCTGGGACAGCAGAGGGCGTCTGATTGCCCTTGAAAATGAAAACGGCGAAGCGTATCAGTTCCGCTGGGGGCCTGACTC
GCTCTTGCTGGAGGAGGTGGGGCTCGATGGTGTGGCCTCGCAGTATCGCTACGACGCCTGTGGGCGCACGATAGCGCGTA
CCTTTGCTGCCGGTCATCCGGAGGCCATCACCCACGCCTTTGCCTGGAGCGCGAGCGGGCAACTGGTCGCCCGCACTACG
CCGGAAGGGCAGACCCGCTACCACTACACCCCGTCAGGGCTGCTGACCCGGATTGGGCTGCACCCGGCGCTTTCAGCCGA
CGCGTGGAGTACCGAGGCTGAGCAGGAGCTTTCCTTTGAGTATGACGCACTTGGTCGCGTGACCCGCGAAGCGGGCGAGC
ACGGTGAGCTGGCATGGCAGTATGATGCCCTTGGCAACCGCACCTCCGTTACGCTGCCGGATGGCCGCGAACTCAAACAG
TTCTACTACGGCAGCGGGCATCTGCTCAGCATTGCCCTTGATAAGTTGTCGGTATCCGACTTTACCCGCGACGAACTCCA
CCGGGAGACCAGCCGCACGCAGGGGCTGCTCACCACCCGCAGCGAATACGACCGTTTAGGCCGCCTGCATCGCCGGGACG
TCTTCACCGGCAACGCCCAGCGCCCGTCACCTCGCCGCTGGTCCCGCCGCTGGGATTATGACTACCGCAATAACCTGGTG
CGGGAAGAACGGGATGATAATCCGTTCAGCTGGTACCGCTGGCAGTACGACAGCGCCGGGCGCCTGCTCGTTCAGGACGG
CACGCTGCCCGGGCAGGAGCAGTGGCGCTGGGATGCGGCCGGTAACCCGCTCGACGGATCTGCTGAAAAGATCACGCACA
ACCGTCTGACGCAGCTGAACGGCATTCGCTGGCGTTATGACATCCACGGCCGCACCGTGGAGAAGGATAACGGCCAGACC
CGCTGGCACTATCGGTACGACGGTGAACACCGCCTGACAGAAGTGATCAGCCAGCCGCGGGATCGTAACAGGCCGCAGAC
GCAGGTCAGCTTCCGTTACGATCCGCTTGGACGCCGCATCAGCAAAACGCGCCAGCAGATGCTGGGCGGACAGGCAACCG
GTAAGCCCATCACCACCCGGTTTGTCTGGGAAGGGTTCCGCCTGCTGCAGGAGCTGCACGGAGACGTGCCGCTGACCTAT
GTCTACAGCGATCAGGACAGCTACGACCCGCTGGCACGTATTGACGGCGTTGATGCTCCGGAGATTTTCTGGTTCCACTG
CCAGCCGAACGGCACGCCGGAACGGATGACGGATATCGAAGGGCAGGTGCGCTGGGAAGGCGTTAACAGCGCCTGGGGCA
AGCTGCTACGGGAAAGCGAGACGCAGCTATCAGGATATTCCCAGAACCTGCGGATGCAGGGGCAATACCTGGACCGTGAG
ACAGGGCTGCACTACAATCTGTTCCGGTATTACGACCCGGACTGCGGGCGGTTTACGCAGCAGGACCCGATAGGGCTGGC
GGGAGGGATAAATCTTTACCAGTATGGTGCTAATAGTCTAACCCGAATAGACCCTCTGGGATTAAAACAAGAGGAAGTTA
TACGCTATATGAGTAAAGATGAAGCGATTGCATCAGCTGCTGAACGCGGTGGTAAAGGCGGATTGGTTCCTAATAATCGT
GGCGATAAAGCCATATGGGTTAATCATGATAGTCGACCAGGATTTAACCCTGGTAATGAAAAGTATCGTGCAGTTATGAC
TGTAAATGATTCTGGGGTTGAGCTTCTTAATCAACACAGTGATATATCAAAGGTTGATTATAAAGAGACCGGCCTGAAGG
ATGGCGTTCTTTCAAAAAGAAATGAACCAGGAGCAAAGGGTATCGGTAAAAATATCCTGGCTCGTTTTAATGATAAAATT
ACCTCATTCCAGATTGAAAAGAAAGATGCTAAAGGTAATTGGAAGAAATGTGGCAAGAGGATTACTTAA