Detailed information of effector


Summary

Effector ID EFF01038 experimental
Effector type Tas
Cognate immunity protein IMU00310 experimental
Related T6SS (Type) T6SS00150 experimental (Type i3)
Strain Pseudomonas aeruginosa UCBPP-PA14
Replicon chromosome
Sequence Protein sequence (461 a.a.); Nucleotide sequence (1383 bp)
Description Tas1 depletes ADP and ATP in target bacteria by synthesizing (p)ppApp
Reference
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) PA14_01140 (Tas1)
Coordinates (Strand) 111195..112577 (-)
NCBI ID 116053814
RefSeq NC_008463
Uniprot ID UPI0000E44884
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
PAAR_motif PF05488.15 4.7e-12 80..151

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-12 MDAQAAARLGDE
Transmembrane helix 13-35 IAHGFGVAAMVAGAVAGALIGAA
Outside 36-38 VVA
Transmembrane helix 39-61 ATAATGGLAAVILAGSIAAGGLS
Inside 62-188 MFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEALGLAA
Transmembrane helix 189-211 LAGGLLLAAMAGVAALVGVVAIG
Outside 212-460 GLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAAKAEIDAVADGLAAKHGGRVAKAPIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANRGAKVKVIDGNADPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPGGQGHKYYEDWRVLDPKSPEAQAIAEKSRAYYDAVRKGNGN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7411 - -



  Protein sequence: 461 a.a.    .

>EFF01038 NC_008463:c112577-111195 [Pseudomonas aeruginosa UCBPP-PA14]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTT
GVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFI
GGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVA
GMALLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAAKAEIDAVADGLAAKHGGRVAKAPIKSRERAMQKINNDYKG
DPTKIKDLARNTIIVEGDKVNTVAAELANRGAKVKVIDGNADPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMA
RILLGNDTYDAVAAKAGVPGGQGHKYYEDWRVLDPKSPEAQAIAEKSRAYYDAVRKGNGN*

  Nucleotide sequence: 1383 bp    .

>EFF01038 NC_008463:c112577-111195 [Pseudomonas aeruginosa UCBPP-PA14]
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCGCCGGAGCCGT
GGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGCCGCGGTGATCCTGGCCGGTT
CGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACCACCATCTTCGAGCTACCCGAGCCGACCACC
GGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACAGTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCAC
CTGCAGCGGCCTGCCGCTGAACCATCCGCTGTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCA
ACGGCAAGCCGGCGGCGCGCCTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGAACACCTTCATC
GGCGGCCCCACCGAGCGGGTGGCCTTCGTTCTCGATCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGTTGGAGTGGTCGCCATCGGCGGGCTGA
TGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCGACCTGTTCCAGGGCGTGGCC
GGCATGGCGCTGCTGGGCTTCGGACCGAAGATGGCACGGCTCGGCAACGCACCCAAGGGCGCGCCGAAGACCCAGGTGCC
GAAAGGCTTCGAGAAGGTCTATGGCAAGGCGCCGGCAGCCAAGGCCGAGATCGACGCGGTGGCCGACGGACTGGCGGCTA
AGCACGGCGGCAGGGTCGCCAAGGCACCGATCAAGTCGCGCGAACGCGCCATGCAGAAGATCAACAACGACTACAAGGGC
GATCCGACCAAGATCAAGGACCTGGCCCGCAACACCATCATCGTCGAAGGCGACAAGGTGAACACCGTTGCCGCCGAGCT
GGCCAACCGCGGCGCCAAGGTCAAGGTGATCGACGGCAACGCCGACCCGCTCGGCTACAGCGGGGTGAACTCGACGATGA
ACACCAAGGCCGGGATACCCGGCGAGATCCAGGTCAACTCGCCGGAGATGATCTACGCCAAGGAGTCGGAGGACATGGCT
CGCATCCTCCTCGGCAACGACACCTACGACGCGGTGGCGGCCAAGGCCGGCGTACCCGGAGGGCAGGGCCACAAGTACTA
TGAGGACTGGCGGGTACTGGATCCGAAGTCCCCGGAGGCCCAGGCCATCGCCGAGAAGAGCCGGGCGTACTACGACGCAG
TGAGGAAAGGCAATGGCAATTGA